KEGG   Nelumbo nucifera (sacred lotus): 104589100Help
Entry
104589100         CDS       T04131                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00052  Galactose metabolism
nnu00500  Starch and sucrose metabolism
nnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104589100
   00500 Starch and sucrose metabolism
    104589100
Enzymes [BR:nnu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104589100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104589100
NCBI-ProteinID: XP_010245596
UniProt: A0A1U7Z4B0
Position
Un
AA seq 573 aa AA seqDB search
MATCSVLSSVLIFFYSNLLIWNNGVFVEASHRVFPQYQPLAVSKVSQRYRTGYHFQPSKH
WINDPNGPMYYNGIYHLFYQYNPRGAVWGNIVWAHSVSTDLINWAPLEPALYPTEPFDIN
GCWSGSATILPGNKPVILYTGIDTQNRQVQNIAVPKNLSDPYLREWTKPGHNPLMVPAGD
INVSSFRDPTTAWWGNGHWKVLVGNKRGRRGMALLYRSRDFVTWKKSPHPLHSAPGTGMW
ECPDFFPVSLAGEEGLDASRTGVGVKHVLKVSLDSSRFEYYTVGRYFPEKDRYIPDNTSA
DNAMGLRFDYGNFYASKTFFDAGKKRRILWGWTNESDTAADDVAKGWAGIQTIPRKLWLD
KSGRQIVQWPIQELEALRQNGVHLRKVHLRKGGIVEVKGITAAQADVEVTFSLPNLKKAE
PFDPSWDDPQQQCSRRGATVEGGVGPFGLLALASRNLDEYTSIFFRVFKAQDKHVVLMCS
DQTRSSLRTEVYKPAFGGFVYVDLEDGKLSLRSLIDNSVVESFGAGGKTCITSRVYPILA
VAEGAHLYAFNNGSEPVQLVKLKAWSMRRPRMN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttgttcagttctctcttcggttcttatcttcttctacagcaatcttctgata
tggaacaatggcgtctttgtcgaagcatctcacagggtcttccctcagtaccagcctctc
gcagtctcaaaagttagccaacgttacagaaccgggtatcactttcaaccctccaagcac
tggattaatgacccaaatggaccaatgtattacaatggcatctaccatctattctaccaa
tacaaccccagaggtgctgtatggggcaacatcgtgtgggcccattcagtatcaaccgat
ttgatcaactgggccccgctcgaaccggctctctacccaaccgaaccattcgacatcaac
ggatgctggtccgggtcggccacaatcctcccaggcaataagcctgttatcctctacaca
ggcatcgacacgcagaaccggcaagttcagaacatagcggtgccgaagaacctgtcggac
ccgtatctccgggagtggacgaagcctggtcacaacccgctgatggtgccggcgggagac
attaacgtcagctcattccgtgaccccacgactgcatggtggggaaatggacattggaaa
gttttggttgggaacaagagaggacgaagagggatggctcttctgtacaggagtagagac
ttcgtaacatggaagaagtcgcctcatcctctgcactctgcgccgggaacggggatgtgg
gagtgcccggatttcttccctgtttcattggccggagaagaaggactagatgcatcaaga
actggggtgggtgttaagcatgttttgaaggtcagccttgattcttcaaggtttgagtac
tacacggtgggcagatatttcccggagaaggaccgatatattcctgataacacatctgca
gataatgcaatggggctgaggtttgattatggcaacttctatgcgtccaagacattcttt
gatgctgggaagaagagaaggattttatggggctggactaatgagtctgatactgctgca
gatgatgttgctaaaggttgggctggaattcagacaattccgaggaaactgtggcttgat
aagagtggaagacagatagtccagtggcccatccaagaacttgaagcgctaaggcaaaat
ggagttcatttgagaaaggtacatctcagaaagggagggattgttgaagttaaaggaata
acagctgcacaggctgatgttgaagtcacctttagtttgccaaacttgaagaaagctgag
ccctttgatcctagttgggatgatccacaacagcaatgtagtcgaaggggagctactgtt
gaaggtggcgtaggaccctttgggttgttggcattagcttccagaaaccttgatgaatac
acatctattttcttcagggtttttaaagcacaagacaaacatgttgtgcttatgtgctct
gaccagaccaggtcttcactaaggacagaagtatataaaccagcatttggaggctttgtt
tatgtagatttagaagatggaaagctgtctctaaggagtctgattgataactctgtggtt
gaaagctttggtgctggagggaagacatgcattacatctcgtgtttaccctatcttagca
gtagctgagggtgctcatttgtatgcatttaacaatgggtctgagcctgttcaacttgtg
aagctgaaagcgtggagcatgcggagaccccggatgaattga

DBGET integrated database retrieval system