KEGG   Nelumbo nucifera (sacred lotus): 104589401Help
Entry
104589401         CDS       T04131                                 

Definition
(RefSeq) cell division control protein 2 homolog
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nnu01001]
    104589401
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nnu03032]
    104589401
   03036 Chromosome and associated proteins [BR:nnu03036]
    104589401
Enzymes [BR:nnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104589401
Protein kinases [BR:nnu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104589401
DNA replication proteins [BR:nnu03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104589401
Chromosome and associated proteins [BR:nnu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104589401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH Kdo
Motif
Other DBs
NCBI-GeneID: 104589401
NCBI-ProteinID: XP_010246016
UniProt: A0A1U7YZD2
Position
Un
AA seq 294 aa AA seqDB search
MDQYEKVEKIGEGTYGVVYKARDRLTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQH
GNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSCPELAKDPRLIKLFLYQILRGIAYCHS
HRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRH
YSTPVDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRYLGTPNEETWPGVTSLPDFKSA
FPKWPPKDLATVVPNLEPAGIDLLSKMLCLDPTKRITARNALEHEYFKDLGFVP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaccagtatgagaaagttgagaagattggagaaggaacttatggtgtggtttacaag
gctcgtgaccgtttgacaaatgagaccatagctcttaaaaaaatccgactggaacaggaa
gatgagggggttccaagcactgcaataagagaaatatcccttttgaaagaaatgcagcat
ggaaacatagtcaggttgcaggatgtagttcacagtgaaaaacgcttgtatcttgttttt
gaatatctggacctggacttaaagaagcacatggattcttgtccagagcttgcaaaggat
ccacgtttaattaaactgtttctatatcaaattcttcgtggaattgcttattgccattcc
catagagttctacaccgagatttgaaacctcagaatttgcttatagatcgtcgtaccaac
gctttgaagcttgcagactttggattagccagggcatttggtattcctgttaggacattc
actcatgaggttgtaacactgtggtatagggcaccagagatcctacttggttcccgccat
tactctacccctgttgatgtgtggtctgtgggttgtatatttgctgagatggtgaaccag
aaacctttattcccgggagactctgaaattgatgaactgttcaagattttcagatatttg
ggtactccaaatgaagaaacatggcctggggtgacctcattacctgatttcaagtctgcc
tttcctaagtggcctcctaaggatcttgcaactgtggtcccaaaccttgaaccagctgga
attgatcttctttctaaaatgctctgcttggatccgaccaaaagaattactgcacggaat
gcactcgagcatgaatacttcaaggatcttggatttgtaccttga

DBGET integrated database retrieval system