KEGG   Nelumbo nucifera (sacred lotus): 104590408Help
Entry
104590408         CDS       T04131                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP57
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nnu03041]
    104590408
   03110 Chaperones and folding catalysts [BR:nnu03110]
    104590408
Enzymes [BR:nnu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     104590408
Spliceosome [BR:nnu03041]
 Complex C
  Other components
   PPlases
    104590408
Chaperones and folding catalysts [BR:nnu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    104590408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase DUF294
Motif
Other DBs
NCBI-GeneID: 104590408
NCBI-ProteinID: XP_010247377
UniProt: A0A1U7Z2L3
Position
Un
AA seq 438 aa AA seqDB search
MESINLARCGESIYGSVFADEFHSRLRFKHRGLVACANAGSPHSNGSQFFITLDRCDWLD
RRNTIFGKVTGDSIFNLLRLGDIETDKNDRPLDPPRILSVEVLWNPFDDIVPRQASGKSL
PYSTTDSESRDQKKKAVKKLNLLSFGEEAEEEEKELATIKEKIKSSHDVLNDPRLLKEEI
PRKEMDPSEVKKARDLQLSVREALSGKKGDPQKGPDSTSHDVSDDDDDDDDNDDDDEAKF
DERMRLQILKKRKELGDLPTRQKLPNERSSQDEHGVSPPRASSEELDDHPKKEKLLLKKK
GIGSEARAERMVEADADLQLLGHAERVRQLQKQKKRRLQGRSEEVLAKLEKFKKSLSAKS
SLLGSKSGEGNDEDVSGWKAHQLSFPRNPFEKDSMDRKDDPNEYVVHDPLLEKGKEKFNK
MQAKLKRREREWAGKSLT
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggagagcataaatttagctagatgtggtgaaagcatttatggaagtgtttttgctgat
gagttccattcgcgactgagattcaagcacaggggcttagttgcatgcgcaaatgcggga
tcacctcattcaaatggaagccagttttttataacattggatcgctgtgactggcttgat
agaaggaataccatttttgggaaggtaacaggtgattccatttttaatcttctaagatta
ggtgatattgagactgataagaatgacaggccattggacccaccaagaatactgtctgtt
gaggttttgtggaacccttttgatgatattgttcccaggcaagcatctggaaaatctttg
ccttactccacaactgactctgagagcagagatcaaaagaagaaagctgtaaaaaagctg
aacttgctttcatttggagaagaagcagaagaagaggagaaggaattggcaaccataaaa
gagaaaattaagagtagtcatgatgtgctgaatgatcctcgtctcctcaaagaagaaata
ccaagaaaagaaatggacccatcagaagtcaagaaagcaagggatttgcaattatctgtg
agagaagctctaagtggaaagaaaggagatccacaaaaaggcccagattctacttctcat
gatgtcagtgatgacgacgatgacgacgacgacaatgatgatgatgatgaggctaaattt
gatgaacgcatgcgtctgcaaattcttaaaaagcggaaggagcttggagatcttccaacc
aggcaaaaattacccaatgagagatcaagccaagatgaacatggagtatctcctccaagg
gccagcagcgaagaacttgatgaccatcccaagaaggaaaagctgttgttaaagaaaaag
ggaataggatcagaagcaagggctgaacgtatggttgaagcagatgcagacttgcagctt
ttgggccatgctgagcgagtaagacaattgcaaaaacagaagaaacgaagactccagggc
cgttcagaagaagtgcttgcaaagctcgagaagtttaagaagtctttatctgcaaaatcc
agcttactaggtagcaaatctggggaaggtaatgacgaggatgtatctgggtggaaggca
catcagttgagttttccacgcaatccttttgaaaaggatagcatggaccggaaggatgat
ccaaatgagtatgtggtgcatgaccctcttctcgagaaggggaaagagaagttcaacaag
atgcaagccaagctaaagcgcagagaacgtgaatgggctggcaaatcgcttacctga

DBGET integrated database retrieval system