KEGG   Nelumbo nucifera (sacred lotus): 104590423Help
Entry
104590423         CDS       T04131                                 

Definition
(RefSeq) probable acyl-activating enzyme 16, chloroplastic
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00061  Fatty acid biosynthesis
nnu00071  Fatty acid degradation
nnu01100  Metabolic pathways
nnu01212  Fatty acid metabolism
nnu04146  Peroxisome
Module
nnu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    104590423
   00071 Fatty acid degradation
    104590423
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104590423
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nnu01004]
    104590423
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nnu04147]
    104590423
Enzymes [BR:nnu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     104590423
Lipid biosynthesis proteins [BR:nnu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   104590423
Exosome [BR:nnu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   104590423
  Exosomal proteins of breast cancer cells
   104590423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 104590423
NCBI-ProteinID: XP_010247392
UniProt: A0A1U7ZGV7
Position
Un
AA seq 732 aa AA seqDB search
MTMISVSPTLVLNSPDARKVFGFFLSRRQAGTSRIFQKRRSSGRCSRLARRPVVCCESNP
EPEEPRVRRCSPLLESVLLSGETILYSGDWKAVPDIWKSSAERYGGLIALVDPYHDPPSE
LTYKQLEQEILNFAEGLRVIGIKPDEKVALFADNSCRWLIADQGIMAIGAINVVRGTRSS
TEELLQIYNHSESTALIMDNPDFFKRIAEGFSSKAVIRSVILLWGEKSCLSNYVIEGLTI
FNYNEIIDLGRESRRVLLETNKGGLHIYETISSDDTATLVYTSGTTGAPKGVMLSHQNLL
HQIKNLWNIVPAEAGDKFLSMLPPWHTYERAAEYFTFTCGVQQVYTNVKNLKEDLRRYQP
HYLISVPLIYETLYSGIQKQISTSSIARKVIAVALIRISLLYMESKRIYEGKVLTRNQKP
HPLIFLMVDWFWARITATILWPLHILGMKLVYSKIHSAIGISKAGISGGASLPLHVDRFF
EAIGVKLQNGYGLTESSPVVAARQPTYNVLGSVGHPLRHTEVKIVDSETGEVLPAGSKGI
VKVRGPQVMKGYYKNPSATTQVLDEEGWLCTGDIGWIAPSHSIGRSRNCGGVLVLEGRGK
DTIVLVTGENVEPSELEESAIRSSLIQQIVVIGQDQRRLGALIVPNKEEILEAAKKRSIL
DADASELSKEKMITLLHEEVRTWTSHCSFQIGPILLVEEPFTIENGLMTPTMKIRRDRVI
ARYSDQIAELYH
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgatctctgtttcccctaccctcgttttgaattcccccgacgcccggaaagtc
ttcgggttctttctctctcgtcgtcaagctggcacttcgcgcatctttcagaaaagacgc
agttctggccgttgttctcggctcgctcggagacctgtggtttgttgcgaatctaatccc
gagccagaggaaccacgagttagaagatgctcccctcttctagagagtgtattactttca
ggtgaaactattctgtattctggtgactggaaggctgttcctgacatttggaaatcttca
gctgaaaggtatggtggtctgattgccttagtggatccatatcatgatccgccatcagaa
ttgacttataagcagctcgagcaggaaattttgaatttcgcagaaggcctaagagttatt
ggaataaaaccagatgaaaaagtagcactttttgctgacaactcatgcaggtggctcatt
gcagatcaagggatcatggctattggagcaattaatgtagtgaggggaacaaggtcatct
actgaagaattattgcagatatataatcattcagagagtactgcactcatcatggacaat
ccggatttcttcaagcggattgcagaaggtttctcttccaaggcagtgataagatctgtg
attcttctttggggggagaaatcatgcctttctaattatgtaatcgagggcttaactatt
tttaactataatgagattatagatttgggaagagagagtcggagggtcctgcttgaaact
aataaaggtggactccatatttatgaaactatcagctctgatgatactgctacacttgtt
tatacaagcggaaccactggtgccccgaagggtgttatgctttcacatcagaatctattg
catcagattaagaacctctggaacattgtacctgcagaagctggagacaagtttctaagc
atgctcccaccatggcatacatatgaacgagctgctgagtattttacatttacatgtggg
gttcagcaagtatacacaaatgtgaaaaacttgaaggaagatctgagacgctatcaacca
cactacctaatttctgttcctctaatatatgagacactctatagtggaatccagaaacag
atttcaacaagttctattgctcggaaggttattgcagttgcactaatcagaataagtttg
ctttacatggaatcaaagaggatttatgagggaaaggtcctaacaagaaatcagaagcca
catccacttatttttttaatggtggactggttctgggcaagaattactgccacaattttg
tggccattgcatatattggggatgaaacttgtctattccaaaattcactctgcaattgga
atatcaaaggctggtataagtggtggcgctagtttgcctttgcatgttgacaggtttttt
gaggcaattggcgtaaaattgcagaatggatatggcttaactgaatcttctcctgttgtt
gctgctcgccaacccacttacaatgtccttggctctgttgggcatccacttcgacataca
gaggtcaagattgtagattctgaaactggtgaagttctcccagctggctcaaaaggcatc
gttaaagttagggggccacaggtgatgaagggttactacaagaatccatcagccacaacg
caagtattagatgaggagggttggctatgtactggtgatataggttggatcgctcctagc
cattcaataggacgaagtcgcaattgtggaggggtgcttgtccttgaaggacgtggcaaa
gatacaattgttcttgtcacaggtgaaaatgttgaaccatcagaacttgaggaatctgct
attcggagtagtctaattcaacaaattgttgttattggccaggatcaacgtcgtcttgga
gctttaatagtcccaaataaagaagagatcttagaagcagccaaaaagaggtccatattg
gatgctgatgcctctgaactgagtaaggagaaaatgatcactcttttgcatgaggaagta
aggacttggacctcacactgctcatttcagattggaccaattctgttagtagaagaaccc
tttacgattgaaaatggcttaatgaccccaaccatgaaaataaggagggacagagtcata
gctcgatacagcgatcaaattgcggaactctaccattag

DBGET integrated database retrieval system