KEGG   Nelumbo nucifera (sacred lotus): 104591788Help
Entry
104591788         CDS       T04131                                 

Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic-like
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00860  Porphyrin and chlorophyll metabolism
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
Module
nnu_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    104591788
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nnu01007]
    104591788
Enzymes [BR:nnu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     104591788
Amino acid related enzymes [BR:nnu01007]
 Aminotransferase (transaminase)
  Class III
   104591788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 104591788
NCBI-ProteinID: XP_010249114
UniProt: A0A1U7ZL27
Position
Un
AA seq 472 aa AA seqDB search
MAAIPGIGLSWRSKVSQRPSLNPPRSSPRRASSQIKVALSVEKKTFTLQKSEEIFTAAKD
LMPGGVNSPVRAFKSVGGQPIVIDSVKGSHMWDVDGNEYIDYVGSWGPAIIGHADDEVLA
ALAETMKKGTSFGAPCILENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRP
KVIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKAATIDTLTSPYNDVVTVEKLFET
HKGEIAAVILEPVVGNSGFITPKPDFLNALRQITKENGALLIFDEVMTGFRLAYGGAQEY
FGITPDLTTLGKIIGGGLPVGAYGGRREIMEIVAPSGPMYQAGTLSGNPLAMTAGIHTLE
RLKEPGSYEYLDKITGELIQGILDAGKRAGHELCGGHISGMFGFFFTEGPIYSFGDAKKS
DTAKFARFYRGMLEEGVYFAPSQFEAGFTSLAHTSDDIQRTVAAAEKVFQRI
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgataccggggattggtctctcatggcggtcaaaggtctctcagagaccctct
ttgaacccacctcgatcttcgcctcgtcgcgcctcttctcaaattaaagtggcactttcg
gttgagaagaagactttcacgcttcagaagtctgaagaaatctttactgccgccaaggat
ttgatgcctggaggtgtaaattctcctgtccgtgctttcaaatcagttggtggacaaccc
attgtgatcgattctgtgaagggttctcacatgtgggacgttgacggtaacgagtacatt
gactatgttggttcatggggtccagcaatcataggtcatgcagatgacgaggtgcttgca
gccttggctgagacaatgaagaaaggaacaagcttcggtgctccatgtattctagagaat
gtgctggcagaaatggtgatatcagctgttcctagcattgagatggtgcggtttgtaaac
tcaggcacagaagcctgcatgggtgtgctccgcctagcccgtgccttcactgggaggccg
aaggtgataaaattcgagggttgctaccatggccatgctgacccattccttgtcaaagct
ggcagtggagtcgcaacccttgggctccctgactcccctggggtcccaaaagctgctacc
attgatacccttacatctccttataatgacgtcgtaacagtggaaaagctttttgagacc
cacaaaggagaaattgctgctgttatccttgaaccagtagttggaaattctggcttcatt
actcccaagcctgatttcttaaatgcccttagacagataacaaaagaaaatggtgctctc
ctaatattcgatgaggtaatgactggattccgtttggcttatggtggagctcaggagtat
tttggcataactcctgatctaacaacacttgggaagattattggaggcggcctgcctgtc
ggtgcttatggagggagaagggagattatggaaattgtggcgccatcagggcccatgtac
caagcagggaccttgagtgggaatccattggcaatgacagctggcatccacacacttgag
cggttgaaggaacctggaagttatgaatacttggataagatcacaggagagctcattcag
ggaattttagatgctggtaagagagctgggcatgagttatgcggtggacatattagtggg
atgtttggtttcttcttcacagaagggccgatctacagttttggggatgcaaagaagagc
gacacggcaaagtttgctaggttttataggggaatgttggaggaaggcgtgtactttgct
ccatcacagtttgaggctggatttacaagcttggctcatacctctgatgatattcaacgg
actgtagctgcagctgagaaggtcttccagcggatttag

DBGET integrated database retrieval system