KEGG   Nelumbo nucifera (sacred lotus): 104594513Help
Entry
104594513         CDS       T04131                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK4
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nnu01001]
    104594513
   01009 Protein phosphatases and associated proteins [BR:nnu01009]
    104594513
Enzymes [BR:nnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104594513
Protein kinases [BR:nnu01001]
 Serine/threonine kinases: Other
  Wnk family
   104594513
Protein phosphatases and associated proteins [BR:nnu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104594513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal POR_N
Motif
Other DBs
NCBI-GeneID: 104594513
NCBI-ProteinID: XP_010253119
UniProt: A0A1U7ZN14
Position
Un
AA seq 628 aa AA seqDB search
MYKARLRERVDGATPPNSGYVETDPTGRYGRFEDVLGRGAMKTVYKAFDEVVGMEVAWNQ
VKLNDVFRSPEELQRLYSEVHLLSTLNHDSIIRFYTSWIDVARRTFNFITEMFTSGTLRE
YRQRYKQVNIRAVKNWARQILRGLVYLHGHNPPVIHRDLKCDNIFVNGHLGQVKIGDLGL
AAILRGSQPAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCVLEMLTSEYPYSECSNPAQ
IYKKVTSGKLPDAFYRIHDLEAQQFIGKCLETASKRMSAKQLLLDPFLASHEEEMLPAPR
ITDHKSITKNPAPEYSHVYLPTPLATPRKTTTDMKITGKMNPEDDTIFLKVQIADKEGCV
RNIYFPFDILSDTPVDVATEMVKELEITDREPFEIAEVIENEISALVPHWKEPEPEPHPH
QTFSYQDDDDDDGPHHAFCSFSSCSSSHASLSGLISSTHISRGEGTFNGCDWLQGDLFAD
DDASSQSSAHSQSSGMYSNINYNSGSEHDFNPSPRRRDYCSAAMSHHQSTRFCPEEKARA
GHSIGMNRQSRRASSSNESGRVDNRQLTRNRSLVDVRSQLLHRTLVEEVNKRRLFKTVGD
VESIGFQSPKGLCEKGSPLKGKKQGFKW
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagcacgactccgggaacgtgttgacggagccaccccccccaactctgggtac
gtcgagaccgatccaaccggccggtatggacgtttcgaggatgttttaggccgaggagcc
atgaagacagtttataaagcatttgatgaggtagttggaatggaggtggcgtggaaccag
gtcaaactcaatgatgtattccggtcacccgaggaattgcagaggctgtattcagaggtt
cacctacttagcaccctaaatcacgactccatcatccgattctacacctcgtggatcgat
gtcgctcggagaacattcaactttatcaccgaaatgtttacttcaggcaccctaagagaa
tatagacagagatacaagcaggtaaatattcgagctgtcaagaattgggcccgccaaatc
ctacgtggtcttgtttatttgcacggtcataatcctcctgtgatccatagggacctcaag
tgcgataatatctttgtcaatggccatctcggacaagtgaagattggtgatttagggtta
gcagccattctccgtgggtctcaacccgcccacagtgtgataggcaccccggaattcatg
gcaccagaactatatgaagaagaatacaacgagctcgtggacatatactcctttggcatg
tgcgttctagagatgcttacttctgagtatccatacagcgagtgctctaacccagctcaa
atctacaagaaagtgacatcgggaaagctgccagacgcattctaccggattcacgacttg
gaagcccaacaattcattgggaaatgcttggagactgcttcaaagaggatgtctgcaaaa
caactcttgctcgaccccttccttgcctctcacgaagaagagatgttgccagctccaaga
attactgatcacaagtcgattactaaaaatcctgcaccagagtacagtcatgtttatttg
ccaacgccacttgctactccgagaaagactactacagacatgaaaattacagggaagatg
aaccctgaagatgataccatctttcttaaagtacagatcgctgataaggaaggttgtgtg
aggaacatatattttccttttgacattctaagtgacaccccggtcgatgttgcgaccgag
atggtgaaagagctggagattaccgatcgtgaaccgtttgagatcgccgaggtgattgag
aatgagatttcagctttggtgccacactggaaggaacctgaacctgaacctcaccctcac
caaacctttagctatcaagatgatgatgatgatgatggacctcaccatgctttctgttct
ttttcctcctgttcttcttctcacgcctcactctctggactgatcagttcaacccacatt
tctcgtggggagggtacatttaatggctgtgattggctccaaggcgacttgtttgctgac
gacgatgctagctctcaaagctctgcacactcacagtcgtcgggcatgtactccaacata
aattacaattcaggcagcgaacatgatttcaatccaagtcctagaagaagagactactgc
tcagctgcaatgtcccaccatcagtccacgagattctgccctgaggagaaggcgagggca
gggcactcgattggtatgaatcggcagtctcgcagagcttctagttccaatgaatcagga
agagtggataatcgtcaattgacaagaaaccgatcattagtggatgtgcgcagtcagttg
ttacaccgcactttggttgaggaggtaaacaagcgtcgcctgttcaagactgtgggtgat
gtggagagtatcggatttcaatctcccaagggattgtgtgagaagggctcaccgcttaag
ggtaagaagcaaggatttaaatggtga

DBGET integrated database retrieval system