KEGG   Nelumbo nucifera (sacred lotus): 104597573Help
Entry
104597573         CDS       T04131                                 

Definition
(RefSeq) formate--tetrahydrofolate ligase-like
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00670  One carbon pool by folate
nnu01100  Metabolic pathways
nnu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    104597573
Enzymes [BR:nnu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     104597573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-GeneID: 104597573
NCBI-ProteinID: XP_010257494
UniProt: A0A1U7ZT47
Position
Un
AA seq 637 aa AA seqDB search
MSSSKTLRKLQVVSPVPADIDIANSVEPFHISEIAKELNLSSNHYDLYGKYKAKVLLSVL
DELQGSGDGYYVVVGGITPTPLGEGKSTTTVGLCQALGAFLDKKVVTCLRQPSQGPTFGI
KGGAAGGGYSQVIPMDEFNLHLTGDIHAITAANNLLAAAIDTRIFHEATQSDKGLLNRLC
PPNKEGKRSFANIMFRRLKMLGISKNNPDDLTPEEVKKFVRLDINPDSITWRRVMDVNDR
FLRKITIGQGPEEKGMVRETGFDISVASEIMAVLALTTSLSDMRERLGKMVIGNSKAGDP
IIADDLGVGGALTVLMKDAIDPTLMQTLEGTPVLVHAGPFANIAHGNSSIVADKIALKLV
GPGGFVVTEAGFGADIGTEKFMNIKCRYSGLTPQCAVIVATIRALKMHGGGPEVVAGKPL
DHAYLSENVTLVEAGCVNLARHISNTKAYGVNVVVAVNMFSTDTEAELNAVRNAALTAGA
FDAVVCTHHAHGGKGAVDLGIAVQRACENVTQPLRFLYPLDISIKDKIDAIARSYGASGV
ELLDSFAEKQIEMYTRQGFSSLPICMAKTQYSFSHIPSEKGAPVGFVLPVRDVRASIGAG
FIYPLVGTMSTMPGLPTRPCFFEIDVDTTTGRVLGLS
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagttcatccaaaacattaaggaaattgcaggtcgtttcacccgttcctgcggatatc
gatatagctaattcagttgaaccctttcacatctcagagattgcgaaagagctaaatctc
agtagcaaccactacgatctctacggaaaatacaaggccaaggtccttttatctgttctt
gatgagcttcaaggatctggggatgggtactatgttgtggttggagggatcactcctacc
cctctcggagaaggcaagtctactactacagttggtctatgccaagcattgggagctttt
ctcgataaaaaggttgtgacctgccttcgtcaaccatctcaaggaccaacatttgggatc
aaagggggtgccgcaggtggtggttacagtcaagtgatcccaatggatgagttcaatctg
cacttaacaggagatatccatgcaattactgcagcaaataaccttctggcggctgccatt
gatactcggattttccatgaggcaactcaatcagataagggccttttaaacagattatgc
ccacctaataaagaaggaaaaaggagctttgcaaatataatgtttaggcgcctcaagatg
cttggtatctcaaagaataaccctgatgatcttacacctgaggaagtgaagaaatttgtg
agacttgatatcaatcctgactccattacctggagaagagttatggatgtaaatgaccgt
ttccttagaaagattaccattgggcaaggtcctgaagaaaaaggaatggtgagagagaca
ggctttgatatctcagttgctagtgagatcatggcagtgctggccctcacaacatccttg
tctgatatgagagagagactaggaaagatggtgatagggaacagcaaggctggtgaccca
ataatagcagatgatcttggtgttggaggtgccttgaccgtgttaatgaaagatgccatc
gaccctactttaatgcagacccttgaggggactccagttcttgtacatgcaggacctttt
gccaatattgctcatgggaattcttccatcgtagctgataagattgcactaaaactggta
ggacctggtggatttgtagtcacagaggcaggttttggtgcagatattggcacggaaaag
tttatgaacataaaatgccgatacagcggtttaacacctcagtgtgctgttatcgttgca
acaataagggccctgaaaatgcatggtggaggacctgaagtggtcgctgggaagcctcta
gaccatgcatatttatccgagaatgtgactcttgttgaagctggctgtgtgaatctggcc
aggcatatctccaacacaaaggcttatggggtcaatgttgtggttgctgtgaacatgttc
tcaactgataccgaggcagagctgaatgcggtgagaaatgcagcattaactgctggtgca
tttgatgctgttgtttgcactcatcatgcccatggtggaaagggagcggttgaccttggc
attgctgttcaaagagcatgtgagaatgtgacacaaccattgaggtttctatacccattg
gatataagcatcaaagataaaatagacgcaatagcaaggtcttatggtgccagtggtgtc
gaattgttagacagttttgccgagaaacaaatagagatgtacaccaggcagggtttttct
tctcttcctatttgcatggcaaaaacccagtattccttctcacatataccatctgagaag
ggagcccctgttgggtttgtgttaccagtcagggatgtcagggccagcattggagccgga
tttatctatcccctagttgggaccatgagtacgatgcccgggcttcccactcggccttgc
ttttttgagattgatgtggacactacaactggaagagttcttggtctttcataa

DBGET integrated database retrieval system