KEGG   Nelumbo nucifera (sacred lotus): 104597681Help
Entry
104597681         CDS       T04131                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00010  Glycolysis / Gluconeogenesis
nnu00562  Inositol phosphate metabolism
nnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104597681
   00562 Inositol phosphate metabolism
    104597681
Enzymes [BR:nnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104597681
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104597681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 104597681
NCBI-ProteinID: XP_010257685
UniProt: A0A1U7ZTM3
Position
Un
AA seq 498 aa AA seqDB search
MATATLLLLCASLLIPSMADELFDVRRHLSTVSRYGAVKDIADNGFVASSIPDGCSAIHL
NLVARHGTRSPTKKRMRELESLANHMEVLLRDARNGKQESLQQIPAWLWGWQSPWKGKQK
GGELISKGEDELYHLGIRTRERFPDLFNEEYHPDIYVIKATQVPRASASAVAFGIGLFNG
RGSLGPGRHRAFSVTTESRASDILLRFYDCCQNYKDYRESQEPMVNKLKEPILDEITSAL
VERYQLNFTRQDIASLWFLCKQEASLLDIVNQACSLFSPSEVALLEWTDDLEVFILKGYG
ESINYRMGVPLLQDVVQSMEQAIKDHEEHRAPGTYEKARLRFAHAETVVPFSCLLGLFLE
GSEFEQIQREEALQLPPKPPQKRSWRGSIVAPFTGNNMLVLYSCPANNSSNYFVQVLHNE
VPVPMPGCYNTNFCPFEVFKERVVNPHLKHDYHLLCNRRSEKQESKPVTSKLVQLLRWPF
FQESEIQSKKHDAEAAEL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggccacggctacgcttctcctgctgtgcgcttctctgctaataccttcaatggccgat
gagttattcgacgttcgtcgacatttgtcaacggtttcaagatatggtgctgtaaaagat
attgctgacaatggatttgtagcttcaagtattccagatggatgtagtgcaatccaccta
aaccttgtggcaaggcatggaactcgttctcctaccaagaaacgcatgagagagctagaa
agcctggccaatcatatggaagttttgctaagagatgcaagaaatggaaaacaagaatca
ctgcagcaaatccctgcttggttatggggatggcaatcaccttggaaaggaaagcagaaa
ggtggggaattgataagcaaaggagaggatgaactctaccatcttggaattaggaccaga
gaaagatttccagatttgtttaatgaggaatatcatccagatatatatgtgataaaggca
actcaggttcctcgggcatcagctagtgctgtggcatttggcattggactatttaatggg
agaggaagtcttggaccagggcgtcatcgtgctttttctgtaactacagagagccgtgca
agtgatatattgcttaggttttatgattgttgtcaaaactacaaggattatagggaaagt
caggaacccatggttaacaagcttaaggaacctattttggatgagatcacttctgcatta
gtggaaagatatcagctgaatttcaccagacaggatattgcttccctttggttcctatgt
aagcaggaagcatctttactggatatagtgaatcaagcttgtagccttttcagcccttct
gaggtagctttgctagagtggacagatgatttagaggtgtttatactgaagggttatggt
gaatcaataaattatcgcatgggagtaccattgcttcaagatgttgttcaatccatggag
caagctattaaggatcatgaagaacaccgagctccaggcacctatgagaaggcaagactt
cggtttgcacatgctgagactgtggtgccattctcttgtcttcttggactctttcttgaa
ggatctgaatttgaacaaatacaaagggaggaagctctgcaactaccaccaaagcctcct
cagaaaagaagttggaggggcagtatagtagcaccttttactgggaacaatatgctggta
ttgtacagctgtccggccaacaattcaagcaattattttgtacaagtactacataatgaa
gttccagttccaatgccgggttgttataacaccaatttctgcccatttgaagttttcaag
gaaagagttgtcaatcctcatttgaagcatgattatcatttactttgcaacagaaggtca
gaaaaacaggagtccaagcctgtcactagtaagttggtgcagttgctccgttggcctttc
tttcaggagagcgaaatacagtctaagaaacatgatgctgaagctgctgaactttag

DBGET integrated database retrieval system