KEGG   Nelumbo nucifera (sacred lotus): 104597955Help
Entry
104597955         CDS       T04131                                 

Definition
(RefSeq) erlin-2-B-like
  KO
K23341  erlin
Organism
nnu  Nelumbo nucifera (sacred lotus)
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nnu04121]
    104597955
Ubiquitin system [BR:nnu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    104597955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 104597955
NCBI-ProteinID: XP_010258063
UniProt: A0A1U8A071
Position
Un
AA seq 357 aa AA seqDB search
MDTQTQEQRARAAQPRPAGGDFSAIISVLMVFVSFAALVVVPSSFSTASNSFSILHQVPE
GHVGVYWRGGALLNTITNPGFHLKMPLITQFEPIQVTIQTDQVRDIPCGTKGGVMISFEK
IEVVNRLRKEYVYETLLNYGIQYDHTWIYDKIHHEINQFCSAHSLQQVYIDMFDQIDEKM
KDALQGDCTRYAPGIEIISVRVTKPKIPESIKRNFEAMEEERTKVLIAIEKQRVAEKEAE
TQKKMALSEAEKNAEVSRIIMLQKLMEKENAKKQQEIENQMYLEREKSLTDANYYRVIKE
AEANKFKLTPQYLELKFIEAIANNSKIFFGDKVPNMLFDQRLLGNFLNDVKKRNLET
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggacacgcagacgcaggagcaaagagcgagagctgctcagcctcgtccagctggtgga
gatttctccgccattatctcagttctgatggttttcgtctccttcgctgccctggtggtg
gttccttcgtcattttcaactgcaagtaatagtttttccatattacatcaagtcccagag
ggtcatgttggggtttactggaggggaggtgcccttctgaatacaataactaacccaggt
ttccatttgaagatgcctctgataactcagtttgagcctattcaagtgactattcagaca
gatcaggtaagggatatcccatgtggtacaaaaggcggtgttatgatcagctttgagaag
attgaggttgttaatcgtcttcgtaaggagtatgtatatgaaacacttctcaactatggt
atacaatatgaccatacatggatatatgataagattcatcatgaaatcaatcagttttgc
agtgctcattctcttcagcaagtttatatagacatgtttgaccagattgatgagaaaatg
aaagatgctcttcagggtgactgtacgcgatatgccccaggtattgaaattattagtgtc
cgtgtcacaaaaccaaaaattccagaaagcataaaacgcaattttgaagcaatggaagag
gaacgcactaaggttttaattgcaattgagaaacaaagggtagctgagaaagaggccgag
acacagaagaagatggctttatcagaagccgagaaaaatgccgaggtcagcaggatcatc
atgttgcaaaagctgatggaaaaagaaaatgccaaaaagcagcaggaaattgaaaaccaa
atgtacctggagcgtgaaaagagcttgacagatgccaactactacagggtgataaaagaa
gctgaagcaaacaagtttaagctcacaccacagtatcttgaactcaagtttattgaagct
atagccaacaattcgaagatcttctttggagacaaggtaccaaacatgctctttgatcag
aggctcctagggaatttcctgaatgacgttaagaagaggaacttagaaacgtag

DBGET integrated database retrieval system