KEGG   Nelumbo nucifera (sacred lotus): 104598456Help
Entry
104598456         CDS       T04131                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00071  Fatty acid degradation
nnu00410  beta-Alanine metabolism
nnu00592  alpha-Linolenic acid metabolism
nnu00640  Propanoate metabolism
nnu01040  Biosynthesis of unsaturated fatty acids
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
nnu01212  Fatty acid metabolism
nnu04146  Peroxisome
Module
nnu_M00087  beta-Oxidation
nnu_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    104598456
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104598456
   00592 alpha-Linolenic acid metabolism
    104598456
   01040 Biosynthesis of unsaturated fatty acids
    104598456
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104598456
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104598456
Enzymes [BR:nnu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     104598456
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 104598456
NCBI-ProteinID: XP_010258829
UniProt: A0A1U8AAX9
Position
Un
AA seq 664 aa AA seqDB search
MEEVDHLAHERNNAEFDVEAMKIVWAGSKHAYEVSDRMARLVASDPVFRKDNRPMLSRKE
LFKNTLRKATHAWKRIIELRLSEEEASRLRFYVDEPAFTDLHWGMFVPAIKGQGTEEQQQ
KWLPLAYKMQIIGCYAQTELGHGSNVQGLETTATFDPNTDEFVIHSPTLTSSKWWPGGLG
KISTHAVVYARLITDGQDHGVHGFIVQLRSLDDHSPLLGITVGDIGVKFGNGAYNTMDNG
VLRFDHVRIPRNQMLMRVSQVTREGKYVQSDVPRQLVYGTMVYVRQTIVSDASCALSRAV
CIATRYSAVRRQFGSQDGGLETQVIDYKTQQSRLFPLLASAYAFRFVGEWLKWLYTDVSQ
RLQANDFSTLPEAHACTAGLKSLTTSSTADGIEECRKLCGGHGYLCSSGLPELFAVYVPA
CTYEGDNIVLLLQVARFLMKTVSQLGSGKKPVGTTAYMGKIEHLMQCQCDVQRAEDWLKP
NVILETFEARAARMSVACAQNLSKFSSPEEGFAELSANLVEAAIAHCQLIVVSKFLEKLQ
QEIPGKGVKEQLEALCYIYALYLLHKHLGDFLSTGCITPKQGSLANDQLRSLYSQVRPNA
IALVDAFNYTDHYLGSVLGRYDGNVYPKLYEEAWKDPLNDSVVPDGYHEYIRPMLKQRLR
AARL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagttgaccacctagctcatgagaggaacaacgccgagttcgatgttgaagct
atgaagatcgtttgggccggctctaagcacgcatacgaagtctcagaccgtatggctagg
cttgttgctagcgatcctgtctttcgcaaagataatagacctatgcttagtcggaaggag
ttgtttaagaacactctaagaaaagcgactcatgcatggaaaaggatcattgagctccgc
ctttctgaagaagaggcatccaggttaaggttttatgtggacgaacctgcttttactgat
ctgcattggggcatgtttgtacctgccataaaagggcaaggcaccgaggagcagcaacag
aagtggttaccattagcatacaagatgcaaataattggatgttatgcacaaactgaactt
ggtcatggctccaatgttcaaggacttgaaactactgcaacatttgatcctaatactgat
gagtttgttatccacagtcctaccctaacttcaagcaagtggtggcccggtggactgggt
aaaatttctacacatgctgttgtgtatgctcgcctcataacagatggtcaagatcatggg
gtgcatggttttatagttcagctaaggagcttggatgaccactcacctcttctgggcatt
actgttggtgatattggagtgaaatttggaaatggagcatacaacactatggataatggt
gttctgcggtttgatcatgttcgcatcccaaggaaccaaatgttgatgcgggtttctcag
gttacaagggaagggaaatatgtgcaatctgatgttccaaggcagctagtttatgggact
atggtttatgtacgtcaaactattgtatctgatgcttcctgtgctttgtcacgagcagtt
tgtattgcaacaaggtatagtgctgtccgaagacaatttggttcacaggatggtgggctt
gagacccaggtgattgattacaagactcagcaaagcagactctttccattgttagcttca
gcatatgcttttaggtttgttggcgaatggctgaagtggttgtacacggatgtgagccag
agattgcaagccaatgatttctcgacattgcctgaagcacatgcatgcactgctggtttg
aagtcattgactacttcttccactgctgatggcattgaagaatgtagaaaactgtgtgga
ggccatgggtatctatgtagcagtgggcttccagaattatttgctgtatatgtccctgcc
tgtacatatgaaggagacaacattgttctgcttttacaggttgcgaggtttcttatgaag
actgtttctcaactgggttctggaaaaaaacctgttggaacaacagcttacatgggaaaa
atcgaacatctgatgcagtgccaatgcgatgttcaaagagctgaggattggttgaagcct
aatgtaatattagagacttttgaggcaagagctgctcggatgtctgttgcctgtgctcaa
aatctcagcaagttttcgagtccagaagaaggctttgcagagctctctgccaatctcgtg
gaagcagccattgctcactgccaattaattgttgtttccaagttccttgaaaagttgcaa
caagaaattccagggaagggggtgaaagaacagctagaggcgctctgttacatttatgcc
ctttacctgcttcacaaacatctgggtgacttcttatcaacagggtgtatcacccccaag
caaggatcacttgccaatgatcagctcagatccctatactcacaggttcgtcctaatgcc
attgccttggttgatgcttttaactacactgaccattaccttggctctgttcttggtcgc
tatgatggaaatgtgtatccaaaactgtatgaagaggcatggaaagatccactcaatgac
tcagttgttcctgatggataccatgagtacattaggccaatgctgaagcaacggctccgg
gcagcacgtctttga

DBGET integrated database retrieval system