KEGG   Nelumbo nucifera (sacred lotus): 104600990Help
Entry
104600990         CDS       T04131                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00350  Tyrosine metabolism
nnu00360  Phenylalanine metabolism
nnu00380  Tryptophan metabolism
nnu00950  Isoquinoline alkaloid biosynthesis
nnu00965  Betalain biosynthesis
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104600990
   00360 Phenylalanine metabolism
    104600990
   00380 Tryptophan metabolism
    104600990
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    104600990
   00950 Isoquinoline alkaloid biosynthesis
    104600990
   00965 Betalain biosynthesis
    104600990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nnu04147]
    104600990
Enzymes [BR:nnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     104600990
    4.1.1.105  L-tryptophan decarboxylase
     104600990
Exosome [BR:nnu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104600990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 104600990
NCBI-ProteinID: XP_010262477
UniProt: A0A1U8A5K9
Position
Un
AA seq 490 aa AA seqDB search
MEGGMKPMDAEQLRENAHKMVDFIADYYKSIESFPVLSQVEPGYLRKIIPDSAPNQPESL
QNVLDDIQAKIIPGVTHWQSPNFFGYFPSNSSIAGFLGEMLSGGLNIVGFSWVTSPAATE
LETIVLDWLAKMLKLPEDFLSSGQGGGVIQGTASEAVLVVLLAARDKALRMFGRNSIGKL
VVYASDQTHSALRKACQIGGIHAENCRLLKTDSSTNYALSPEVLTEAISQDTASGLVPFF
LCATVGTTSSTAVDPLLALGKIAKDNKMWFHIDAAYAGSACICPEYRHYLNGVEEADSFN
MNAHKWLLTNFDCSVLWVKDRSALIQSLSTNPEYLKNKASEGNMVVDYKDWQIPLGRRFR
SLKLWMMLRLYGQENLLNYLRNHIELAKYFEELVSVDQRFEIVVPRTFSLVCFRLLPPQG
DEDCINKMNRDLLEVVNSTGKIFLSHTILSGKYILRLAVGAPLTEGRHISAAWKVLQDEA
TTLLEQYMKT
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgggatgaaaccaatggacgctgagcagctcagagagaatgctcataagatg
gtagatttcattgctgattactacaaaagcatagaaagttttcctgttctcagtcaagtc
gagcctgggtatctgcgtaaaattatacccgattctgcgcctaaccagcctgaatcactc
caaaatgttcttgatgatattcaagcaaagataataccaggggtaacccattggcaaagt
ccgaatttttttggatattttccttctaatagcagtattgctgggttcttgggagaaatg
ctcagtggtggtcttaatattgtgggtttcagttgggtgacttctcctgctgcgaccgaa
cttgaaaccattgttctggattggcttgctaaaatgctgaagctaccagaagatttcctt
tcatctgggcaaggtggtggtgtgattcagggtacagcaagtgaagcagttctagttgta
ttgttggctgcacgggacaaggctttgaggatgtttggaagaaactccattggaaaactt
gtggtgtatgcatctgatcaaacacattctgctttacggaaagcctgccagattggtggt
attcacgcagagaactgtagactgctgaaaactgactcttctacaaattatgctctttct
cctgaagtgttaactgaagcaatctctcaggacactgcatctggtctagttccctttttt
ctttgtgctacagttggtactacctcttcgacagcagtggacccattgcttgcattggga
aagattgctaaagataacaaaatgtggtttcacattgatgcggcatatgctggaagtgct
tgtatatgtccagaatatcgccactatcttaatggtgttgaagaagcagattcattcaat
atgaatgcacataagtggctccttacaaactttgactgttcggtgctttgggttaaggat
cgaagtgctttgattcaatccctttctacaaatccagagtatctaaaaaacaaggcctca
gaaggaaatatggttgttgattacaaagattggcaaattcctctaggacgtcggttcaga
tcattgaagttatggatgatgctacgcctatatggtcaggaaaatctactaaattaccta
cgaaaccatatagagctggctaaatattttgaagaacttgtttctgtagatcaaagattt
gagattgttgtgcctcggacattttcacttgtttgcttccgccttctgcccccacaaggt
gatgaggattgcatcaataaaatgaatcgtgacttactggaggtggtaaactcaactgga
aaaatcttcctatcacatacaattctatctgggaagtatattctacgcctcgcagtggga
gctccattgacagagggaagacacataagtgcagcatggaaagtgttgcaagatgaggca
actacgttgttagagcagtatatgaagacttaa

DBGET integrated database retrieval system