KEGG   Nelumbo nucifera (sacred lotus): 104604610Help
Entry
104604610         CDS       T04131                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
nnu  Nelumbo nucifera (sacred lotus)
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nnu04131]
    104604610
Membrane trafficking [BR:nnu04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    104604610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin WD40 ANAPC4_WD40 zf-RING_2
Motif
Other DBs
NCBI-GeneID: 104604610
NCBI-ProteinID: XP_010267348
UniProt: A0A1U8AVT1
Position
Un
AA seq 967 aa AA seqDB search
MSQNLAENGIDGDDEREEEEEDYEEEAEDEDEEEGEEEEEEEEEEEEPRLKYQRMGGSIP
SLLSNDAASCIAVAERMIALGTHDGTVHILDFLGNQVKEFSAHTATVNDLSFDTEGEYVG
SCSDDGNVVINSLFTDERMKFEYHRPMKAIALDPDYSSKSSQRFVAGGLAGHLYLNTKKW
IGFRDQVLHSGEGPIHAVKWRTSLIAWANDAGVKVYDTANNQRITFIERPRGSPRPELLL
PHLVWQDDTLLVIGWGTSVKIAAIRANQYTGANGVQRHIPVSSMKHVDIVGSFQTNYFIS
GIAPYGDALVVLAFIPEKEDGEKNFNSTLPSRQGTAQRPEVRIVTWKNDELATDALPVYG
FEHYKAKDYSLAHSPFSGSSYAGGQWAAGDEPLYYIVSPKDVIIAKPRDAEDHIAWLLQH
GWHEKALAAVEAGQGRTELLDEVGSRYLDHLILERKYAEAAMLCPKLLRGSASSWERWIF
HFAQLRQLPVLVPYIPTENPRLRDTAYEVALVALATNPSFHKDLLATVKSWPPVIYSALP
VISAIEPQLNTSSMTETLKEALAELYVINEQYEKSLALYADLMKPDIFDFIDKHNLHDAI
SDKVVQLMLVDCRRAVSLLIQHRGLITPSEVISQLLDTSNKCDSRYFLHLYLHSLFEVNP
HAGKDFHDMQVELYAEYDPKMLLPFLRSSQHYTLEKAYDICVKRDLLREQVFILGRMGNS
KQALAIIINKLEDIEEAIEFVSMQHDDELWEELIKQCFNKPEMVGVLLEHTVGNLDPLYI
VNMVPNGLRIPRLRDRLVKIITDYRTETSLRHGCNDILKADCVNLLVKFYKEARHGVYLG
SGEEEGRTSRNKSRATEVAEKTSSMKSVELKSKTRGGGRCCMCFDPFSIQNVSVIVFFCC
HAYHLSCLMDSTNSASHKSGSRATPKEPASNYEYNYDYDDDSDDDSDETNQSGAYRMRCI
LCTTAAG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaatctcgcagaaaacggcatcgatggggatgatgagagggaagaagaggag
gaagactacgaagaagaagctgaggatgaagacgaggaggagggggaggaagaggaggag
gaagaagaagaagaggaggagccgaggctcaagtaccagagaatgggagggagcatccct
tcgcttctctcaaacgatgccgcctcttgtattgctgttgctgagcgtatgatcgctctt
ggtacccatgacggcaccgttcatatacttgattttctgggcaatcaggttaaggaattc
tctgctcacactgctaccgtcaatgatcttagctttgatacagaaggtgaatatgtggga
agctgttctgatgatggaaatgttgttataaacagcctttttacagatgaaagaatgaag
tttgagtatcatcgcccaatgaaggctattgctctggacccagattattcaagcaaatca
tcacagaggtttgtcgctggtggtctagcaggacatctttatctaaacacaaagaaatgg
ataggcttccgtgaccaggttctacattctggcgaaggaccaatacatgctgtgaagtgg
aggacaagtcttattgcttgggccaatgatgcaggtgtgaaagtttatgacacagccaat
aatcagagaattacttttattgagcggccacgaggaagcccacgtcctgagctgttgctt
cctcatttagtttggcaggatgatactcttttggttattggttggggaacatcagtaaaa
attgctgccataagagcaaatcaatatacaggagccaatggggtacaaaggcacatacca
gtatccagtatgaagcatgtggatattgtgggatcttttcaaaccaactatttcatttca
ggaattgctccatatggtgatgctttggttgttctagcttttattcctgagaaagaggat
ggtgaaaaaaactttaacagtactcttccatcacgccagggaactgcacagaggcctgaa
gtacgcatagtcacatggaaaaatgatgaacttgcaacagatgctttacctgtgtatggg
tttgagcattacaaggcaaaggattattcccttgcacattctcctttctcaggtagcagt
tatgcaggtggtcagtgggctgctggagatgaaccattgtactacattgtctcccctaag
gatgtaattatcgcaaagcctagggatgctgaagaccacattgcttggcttcttcaacat
ggatggcatgaaaaagcattggctgcagttgaagcaggacaggggcggacagagcttctt
gatgaggtgggatcaagatatctagatcatttgattttggaaaggaaatatgctgaagct
gcaatgttgtgtccaaagttgttacgtggatctgcttcttcatgggagaggtggattttc
cactttgctcaacttcgccagcttcctgtgttggttccatacatcccaacagaaaaccca
agattgcgtgatactgcttatgaggtggcacttgtagccctggcaacgaatccatctttt
cacaaggacctcttggcaactgttaaatcctggccaccagtaatatattctgcattgcct
gtgatatcagcaatagaacctcagcttaatacttcatctatgactgagactctcaaagag
gcattggcggagttatatgtaatcaatgaacaatatgagaaatctcttgcattatatgcc
gatcttatgaagcctgatatatttgacttcatcgacaaacataatttgcatgatgccatt
tctgacaaggttgtccaactaatgttagtggattgcagacgtgcagtctctttactgatc
caacataggggtttgattactccatctgaagtgatttcacaacttttagataccagtaat
aagtgtgattccagatacttcttacacttgtatcttcattcactgttcgaagttaatcca
catgctggaaaggacttccatgatatgcaggtggagctctatgcagagtatgatccaaag
atgctgcttccttttcttcgtagtagtcagcactatacactagagaaggcatatgatatc
tgtgtcaaaagagatcttctgagagaacaggtttttatccttggaaggatggggaattca
aaacaagcccttgccattatcattaacaagttagaggacatagaagaggcaatagagttt
gtgtcaatgcagcatgatgatgaactttgggaagaactaattaaacagtgttttaataag
cctgagatggtgggtgttttgttggagcacactgttggtaatcttgacccactttatatt
gtaaatatggtgcctaatggtttaaggatacccaggcttcgagatcgcttagtcaaaatc
atcacagattacagaacagaaacttctcttagacatggatgcaacgatatccttaaggca
gactgtgttaacctcttggtcaagttttataaggaagcgcggcatggagtttatttgggt
agtggagaagaggaaggacggacaagcaggaataaaagtagagctactgaagtagctgag
aaaacatcaagcatgaaatctgttgagttgaaatcgaaaacaaggggtggtggaaggtgt
tgcatgtgctttgatcccttctctatccagaatgtctcagttatagtattcttttgctgt
catgcatatcacctctcatgtctcatggactccacaaattctgctagtcataagagtggg
tcccgagccactcccaaggaacctgcatcgaattatgaatataattatgattatgacgac
gacagcgatgatgacagcgacgaaactaaccagtctggtgcatatcggatgcgttgtatt
ttatgtactacagctgcagggtga

DBGET integrated database retrieval system