KEGG   Nelumbo nucifera (sacred lotus): 104605459Help
Entry
104605459         CDS       T04131                                 

Definition
(RefSeq) receptor kinase-like protein Xa21
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nnu01001]
    104605459
Enzymes [BR:nnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104605459
Protein kinases [BR:nnu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   104605459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr ABC1 APH
Motif
Other DBs
NCBI-GeneID: 104605459
NCBI-ProteinID: XP_019054660
UniProt: A0A1U8Q9A6
Position
Un
AA seq 316 aa AA seqDB search
MEKKNVPPSVDSLHAMEHRMISYYELLQATNNFHHENLLGTGSFSSVYKAILSDGIIVAV
KVLNLQIEGAIKSFDAECQVLRNARHRNLVKIISSCSNLDFRALIMQYMPQGSLEKWLYC
ENYFLNLLQRINIMIDVALALEYLHHNQSEPVVHCDLKPSNVLLDEDMVAHVGGFGIAKI
LSANDQSVVQTKTLGSIGYIAPEYGSEGRFSTSCDVYSYGILLMEVFTRKKPTDEMFAGD
LSLRRWVHMSLPSELMEIMDKNFIGNEENDSPTKRQIFVSIMELSLDCSRELPEERITMG
EVAARLNKVKKQLLLT
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagaatgtcccaccaagcgttgattcattacatgcaatggaacatagaatg
atttcctactatgagctacttcaagcaacaaacaacttccatcatgaaaacttgcttgga
acagggagtttcagttcagtatacaaagctatattgtctgatggaatcattgttgctgtg
aaagttttgaatctgcaaattgaaggagcaattaagagttttgatgcagaatgtcaagtg
ttgcgaaatgctcgacacagaaatcttgtcaaaataatcagcagttgttccaatcttgat
tttagagctttgataatgcaatatatgccacaagggagccttgaaaaatggctgtactgc
gagaactatttcttgaatctcctccaaaggataaacatcatgattgacgttgccttggca
ctggagtatctacatcacaaccaatcggagcctgtggtgcattgtgatctgaagcccagt
aacgtcctccttgacgaagacatggtagctcatgtgggtggctttggcattgcaaagata
ttaagtgcaaatgatcaatctgtagtgcaaaccaagaccctgggaagcataggatacatt
gcacctgaatatgggtcggaaggaagattttccacaagctgtgatgtttatagctacggg
atcttgttgatggaggtgtttacaagaaagaagcctacagatgaaatgtttgctggagac
ttgagcctaagaagatgggtacatatgtcgcttccaagtgaactaatggaaatcatggac
aaaaattttattggcaatgaagaaaatgattcacctacgaaacgacaaatctttgtctcc
atcatggaattaagtctagactgttcaagagaattacctgaagagaggattaccatgggt
gaagttgccgcaagacttaataaggttaagaagcagcttttgttgacttga

DBGET integrated database retrieval system