KEGG   Nelumbo nucifera (sacred lotus): 104605946Help
Entry
104605946         CDS       T04131                                 

Definition
(RefSeq) 5'-3' exoribonuclease-like
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104605946
Enzymes [BR:nnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     104605946
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-GeneID: 104605946
NCBI-ProteinID: XP_010269212
UniProt: A0A1U8B077
Position
Un
AA seq 460 aa AA seqDB search
MNSSGDGNGGNMTKKAKKKGGSKKNKKMTVEQSLAAKYVSEWAFLDSNSASTSSSVDDFG
VQRSHNKFADRVVFELHSHSTRSDGVLSPTALVERAHRNGVKVLALTDHDTMSGIHEALE
ASHKFGIKIIPGVEISTIFSPRGESEAEEPVHILAYYSSCGPTRFEELENCLENIRDGRY
LRAKNMVSKLNNLKIPLKWENVVRIAGNGVAPGRLHVARAMVEVGHVENLKQAFDRYLYD
GGPAYSTGNELLAEETVELICRTGGVAALAHPWSLKNPVAVIRRLKDAGLHGMEVYRSDG
KLAVFSDLADTYDLLKLGGSDFHGRRSRDESDLGSVNLPVQAVHEFLRFSRPIWCSAIKD
TLQRFAEEPSDSNLERIVKFGKIKYLKVGSTLNCGKDLLDLCLSSWLTNEERETIDVEVL
GLKLSQTVINQRGIQGPLYPIYASQDPRWLNPLFKCQFSV
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcagtggtgacggcaacggcggaaatatgacgaagaaagccaagaagaagggt
ggcagtaagaagaataagaagatgactgtggagcagagtcttgctgccaaatatgtgagc
gaatgggcttttctggattctaattccgcttctacttcttcttctgtcgatgattttggg
gtgcagaggagtcataataaatttgcggatagggtggtattcgagttacattctcattcg
actcgtagtgatggggttttgtctcctacagcgcttgttgagagagcccatagaaacggg
gtaaaagttcttgccttaactgatcatgataccatgtctggcatccatgaagccctggaa
gcttctcacaagtttggcatcaagattattccaggcgttgagatcagtacaatattttct
ccaagaggggagtctgaggctgaggagccagttcacatccttgcatattacagcagctgt
ggccccacaagatttgaggaactagagaattgcttggaaaacataagagatggccgttac
ctccgtgcaaagaatatggtttcaaagctaaataacctcaagatacctcttaaatgggag
aatgttgtcaggattgcaggaaatggagtggctcctggaaggttgcatgtggctcgtgcc
atggttgaagtagggcatgtggagaatctgaagcaagcttttgatcgatatctatatgat
ggtggacctgcctactctactggtaatgagctccttgcagaggaaacagtggaactgata
tgtcggacaggaggtgtggcagctttagctcatccatggtctctgaagaaccctgttgca
gttatcaggaggttgaaagatgcaggccttcatgggatggaggtttacagaagtgatgga
aaattggcagtgttcagtgacttagccgacacctatgatcttttgaagcttggaggatct
gacttccatggtagaagaagtcgtgatgagtctgatctgggaagtgtgaatctacctgtg
caggcagtgcatgagttccttaggttttcccgacctatttggtgcagtgcaatcaaggac
acgctgcagcgttttgctgaggaaccatcggattcaaatctagagaggattgtgaagttt
ggaaagatcaagtaccttaaagttggttcaaccttgaactgtggtaaggacctgcttgac
ctctgcctctcatcatggctaacaaatgaagagagagagacaattgatgttgaggtcctc
ggcttgaagctttcccagactgtcataaatcagagaggcattcaggggccattataccca
atctacgcctcccaagatcccagatggctgaatcctttgtttaaatgccaattttctgtt
tga

DBGET integrated database retrieval system