KEGG   Nelumbo nucifera (sacred lotus): 104607641Help
Entry
104607641         CDS       T04131                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00052  Galactose metabolism
nnu00500  Starch and sucrose metabolism
nnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nnu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104607641
   00500 Starch and sucrose metabolism
    104607641
Enzymes [BR:nnu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104607641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104607641
NCBI-ProteinID: XP_010271619
UniProt: A0A1U8B6U0
Position
Un
AA seq 573 aa AA seqDB search
MATLCWALIFFYGFCFSNLRSNNGVVEASHRIFPEYQSLAAAKVNQLQRTGYHFQPPKNW
INDPNGPMYYNGVYHLFYQYNPKGAVWGNIVWAHSISFDLINWVPLEPAIFPSEPFDING
CWSGSATILPGNKPVILYTGIDTQNRQVQNIAVPKNLSDPYLREWVKPRYNPLMAPVQGV
NASAFRDPTTAWMGKDGRWRVLVGHKRGSRGMALLYRSRNFVTWTKAQHPLHSVAKIGMW
ECPDFFPVSLEGEDGLDTSRGGHGVKHVFKVSLDVTRFEYYTVGKYFPEKDRYVPDNTSP
DNAMGLRYDYGNFYASKTFFDAGKKRRILWGWANESDTAADDIAKGWAGIQTIPRKLWLD
KSGKQLIQWPIQEVESLRLNGVHMSKVNLNKGGIVEVKGISVAQADVEVTFSFKNLDKAE
PFDPNWVDPQQLCGHKGATVEGGVGPFGLLTLASSNLDEYTSVFFRIFKAQKKHVVLMCS
DQTRSSLRTEVYKPSFGGFVDVDLEDGVLSLRSLIDHSVVESFGAGGKTCITSRVYPLHA
VAENAHLYAFNNGTEAIQIVKLEAWSMFRPRMN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggctaccctttgttgggccttgatcttcttttatggcttctgtttcagtaatctgaga
agcaataatggcgtcgtcgaagcgtctcacaggatcttcccagaataccagtctcttgca
gcggccaaagtcaaccaactgcagagaactggctaccactttcaaccccccaagaattgg
attaatgatccaaatggtcccatgtattacaatggcgtctaccatctgttctaccaatac
aaccccaaaggtgcagtctggggcaacattgtctgggcccattcgatatcatttgatttg
atcaactgggttcctctcgaaccagccatatttccctctgaaccattcgacatcaatggc
tgttggtctgggtcggcgacgatcctcccaggcaacaaacctgttatcctctacaccggc
atcgacacccagaatcggcaggttcagaacatcgcagtgccgaagaacctgtccgaccca
tacctcagggagtgggttaagcctcgttacaacccattgatggcgcccgtgcaaggcgtc
aatgcgagtgcattccgtgacccgaccactgcatggatgggaaaggatgggcgctggaga
gttctggttgggcacaagagaggaagcagggggatggcccttctttacaggagcagaaac
ttcgtaacatggaccaaagcgcagcaccctcttcactctgtggctaagataggcatgtgg
gagtgcccagatttcttccctgtttctctggaaggtgaagatggactggatacatctaga
ggcggccatggcgttaagcatgtttttaaggtcagtcttgacgttacaaggtttgagtac
tacacagtgggcaaatattttccagagaaggatcgctatgtacctgataacacatctcct
gataatgcaatggggctgagatatgattatgggaatttctatgcatcgaagacattcttt
gatgctgggaagaagagaaggattttgtggggctgggctaatgagtctgatactgctgcc
gacgatattgcaaaaggctgggctggcattcaaacaataccaaggaagctgtggcttgac
aaaagtggaaaacaactaattcaatggccgatccaagaggttgaatctctaaggctaaat
ggagtccatatgagtaaagtaaacctcaataagggaggtattgtggaggttaaaggaata
tcagttgcacaggctgatgttgaagtcacattcagtttcaaaaatctggacaaagctgag
ccctttgatcctaattgggtcgatccacagcagctctgtggccacaagggtgccactgtt
gagggtggtgtaggcccctttgggttgttgacattggcttccagcaatctagatgaatac
acatctgttttctttaggattttcaaagctcaaaagaaacatgttgtgctcatgtgctct
gaccagaccaggtcctctttaaggacagaggtgtataaaccatcctttggaggttttgta
gatgtagatttagaagatggagtgctatctcttaggagtttgattgatcactctgttgtg
gaaagcttcggtgctggagggaagacatgcattacatctcgagtttatcccctccatgca
gtagctgagaatgctcatttgtatgcatttaacaatgggactgaagctattcaaattgtc
aagttagaggcatggagcatgttcagacctaggatgaactaa

DBGET integrated database retrieval system