KEGG   Nelumbo nucifera (sacred lotus): 104610284Help
Entry
104610284         CDS       T04131                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00906  Carotenoid biosynthesis
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
Module
nnu_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    104610284
Enzymes [BR:nnu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     104610284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 104610284
NCBI-ProteinID: XP_010275132
UniProt: A0A1U8BFB4
Position
Un
AA seq 637 aa AA seqDB search
MKSVSSEFLNTNRERMDAFSSSFFQHPNLLLSPPPNKSTTATVTSPHSPLFTISAVRIEE
RSQSTTKTKPATPRQPQKPETPLSSTTTTTTRIASPTTSPTTRIQTPPVGTTSATRRTPE
LSIPFTIFNAFDDIINNFIDPPLRPSVDPKYVLADNFAPVDELPPTDCPVIEGKLPPCLN
GVYIRNGPNPQYLPRGPYHLFDGDGMLHSLRFSGGRATFCSRYVKTYKYNVERQLGHPVL
PNVFSGFHGLTATVARGAVSAGRILTGQYNPINGIGLSNTSLAFFGNRLFALGESDIPYQ
VRLTPEGDIQTIGRWDSDGKLSMSMTAHPKIDADTGEAFAFRYAPVPPFLTYFYFDANGV
KQPDVPIFSMTRPSFLHDFAITKKYAIFADIQIGMNPMEMIVGSGSPVGSDPAKVSRIGV
IPRYAKDESEMRWFDVPGFNIIHAINAWDEEDEDAIVLIAPNILSVEHTLERMELVHALV
EKVRIDLKTGIVSRFPVSARNIDFGVVNPDFTAKKSRYVYLGVGDPMPKISGVVKLDVSG
EQRQDCTVGCRMFGPGCFGGEPFFVASNPESRDPADEDDGYVVSYVHDENSGESRFLVMD
ARSPTLEVVAAVKLPRRVPYGFHGLFVSEADLRSCKV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgtgtcatccgaatttctgaacacaaacagagaaaggatggatgccttctca
tcctctttcttccaacacccaaatctccttctctctcctcctcctaataagtccaccact
gcaacagttacctctcctcacagtccgctcttcaccatctccgcagttagaattgaagag
agatcccagagcacaacaaagacaaagccagctactccacgccagcctcagaaaccagaa
accccactcagttccaccaccaccaccaccacaagaattgcttcacctaccacctcacct
actacaaggattcagactcctccggtaggcactacctctgctactagaagaacccctgag
ttgtctattccattcaccatctttaatgcattcgacgacatcatcaacaacttcatcgac
cctcccctccgcccctccgtcgacccaaaatacgttcttgctgacaacttcgctcccgtc
gacgagcttccccccaccgactgccccgttatagaagggaagcttccaccgtgcctcaat
ggcgtctacatccgaaacggtcccaacccacagtaccttccacgtggtccttaccacctt
ttcgatggcgacggcatgcttcactctctccgcttttccggaggccgtgccaccttctgc
agccgctacgtcaagacttacaagtacaatgtcgagagacagctcggccatcccgtgctg
ccaaacgttttctcaggctttcatggcctcacagcaactgtcgcccggggagcagtttct
gccggaagaatccttacagggcagtataaccccattaacggcatcggtctttccaacacg
agccttgccttctttggaaaccgactcttcgctctgggcgagtcagatattccctaccaa
gttcgattgactccagaaggagacatccagactattggacgttgggactccgacggcaaa
ctttccatgagcatgacggcccacccgaagatagacgccgacaccggcgaggccttcgca
ttccggtacgcccctgtgccaccatttctcacctacttctacttcgatgcgaacggggtg
aaacagccggacgtgcccatcttctccatgacccgtccatcgttccttcacgacttcgcc
ataacaaaaaagtacgccatcttcgctgacatacagatagggatgaacccaatggagatg
atcgtgggaagcgggtctccagtgggttcagaccccgcgaaggtatctagaatcggcgtg
attccacggtacgccaaggacgagtccgagatgagatggttcgacgtacctggcttcaac
atcattcacgccatcaacgcgtgggacgaagaggacgaggacgcaatagtcttgatcgcg
cctaacatcttatcggtggagcacaccttggagagaatggaactggttcacgctttggtg
gagaaggtgaggatcgacctcaagaccggtattgtgtcgaggttccccgtgtcggcgagg
aacatagatttcggggtggttaacccagacttcacggcgaagaaaagccggtacgtgtat
ctcggcgttggggatcccatgcccaagatatcgggggtggtgaaactggacgtgtcgggg
gagcagcgccaggattgtaccgtgggatgccggatgttcgggccgggatgttttggggga
gagccgttcttcgtagcgagtaaccccgaaagcagggatccggccgatgaggacgacggg
tacgtggtgtcgtacgtgcatgatgagaattccggggagtcgaggttcttggtgatggac
gccaggtctccgacgctggaggttgtggctgccgtgaaacttccccgtcgggtgccctac
ggcttccatggcctctttgtaagtgaggcggatctcagaagctgtaaagtgtaa

DBGET integrated database retrieval system