KEGG   Nelumbo nucifera (sacred lotus): 104610551Help
Entry
104610551         CDS       T04131                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00630  Glyoxylate and dicarboxylate metabolism
nnu00710  Carbon fixation in photosynthetic organisms
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
nnu01200  Carbon metabolism
Module
nnu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nnu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
nnu_M00532  Photorespiration
nnu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104610551
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104610551
Enzymes [BR:nnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     104610551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 104610551
NCBI-ProteinID: XP_010275523
UniProt: A0A1U8BG54
Position
Un
AA seq 180 aa AA seqDB search
MSAIALSTPLVRSSYTGLKPSSPKLFPAKDSIGWRLKTVSNGSRTHCMKTWNPINNKKFE
ALSYLPPLSDESIAKEIEYIIRKGWIPCIEFDEVGHVHRSNSRMPGYYDGRYWTLWKLPM
FGCSNSSQVLEEIHECKKMYPNAYIRCLAFDNKRQAQCMAFVIQKPSTASTTTNTACGCP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccattgccctttccactccgttggtcagatccagctacacaggcctgaaaccc
agttccccgaagctgttcccggcgaaggattcgatcgggtggaggttgaaaactgtctcc
aatggctccaggactcactgtatgaagacatggaatccaatcaacaacaagaagttcgag
gcgctctcgtatctcccacctctctcagatgagtcgatcgcaaaggagatcgagtatatc
attcgaaagggatggatcccctgtatcgaattcgacgaggtgggtcatgtgcataggagt
aatagcaggatgcctgggtactatgatggtagatattggacactgtggaagctacccatg
tttgggtgcagcaactcatctcaggtgctggaggagatccatgagtgcaagaagatgtat
cccaacgcctatatccgttgcttggcctttgacaacaagcgacaggctcagtgcatggcc
ttcgtcattcaaaaaccatccacagcctccactactaccaacaccgcctgcggctgccct
taa

DBGET integrated database retrieval system