KEGG   Nelumbo nucifera (sacred lotus): 104612501
Entry
104612501         CDS       T04131                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00100  Steroid biosynthesis
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
Module
nnu_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    104612501
Enzymes [BR:nnu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     104612501
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 104612501
NCBI-ProteinID: XP_010278239
UniProt: A0A1U8BAA8
Position
Un
AA seq 369 aa
MDLESLLHPLIPTWSSVVLLLSFFVYLGFAGSLIPGKIVPGAILSDGTRLHYRCNGLALL
ILLVATLEVGVRMKLVSPTVIADRGLELLSATLGFSFLVTLALYVAGRNSHDQGSSLKPH
ITGNIIHDWWFGIQLNPQFMGIDLKFFFVRAGMMGWLLINLSVLAKSIQSGSLSTSMILY
QLFCMLYILDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKVELT
KAAVVANCLVFLIGYRVFRGANKQKHIFKKNPKAPIWGTPPKVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGASSPIPYFYPIYLLILLIWRERRDEARCAQKYKDVWAEYCKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatttggagtctcttctccacccattaatccctacatggagctctgttgttctactt
ctctcattcttcgtttacttgggttttgctggatctcttatacctgggaagatcgttccc
ggcgccatcctatcagatggcactagacttcattatcgatgcaatggcttggctttactt
attcttttggttgcaaccttagaagtcggggtgcgaatgaaattggtgtcgccgacggtg
attgcagacagaggacttgagttactttccgctactcttggattcagcttccttgtgact
ttggcactttatgttgctggtcgcaattctcatgatcaaggttcctctttaaagccacat
atcactggaaatataattcacgattggtggtttggaatacagctgaatcctcagtttatg
ggaattgatctcaaatttttctttgttagagctggaatgatgggatggctgctaatcaat
ctttcagttctagctaaaagcattcaaagtggcagtttgagcacatctatgatcctttat
cagctattctgtatgttgtacattctggattactttttttatgaggagtacatgacctca
acatgggacatcattgcagagaggttgggattcatgttggtttttggagatttagtatgg
atccccttcactttcagtatccagggttggtggctattgagcaacaaagtggagctgaca
aaagctgctgttgttgcaaattgcttggtatttctgattgggtatcgggtctttagagga
gctaacaagcaaaagcatatttttaaaaagaatcctaaggcacctatatggggtacacca
ccaaaagttattgggggaaagctgcttgcctctggttactggggaatagccagacactgt
aattacttgggggacttgctattggcactatcctttagtttaccttgtggagccagctct
ccaattccatatttttaccctatataccttcttattctgctgatatggagagagagaaga
gatgaagcccgatgtgcccagaagtacaaagacgtttgggcagaatactgcaaacttgtt
ccgtggaggatactaccatatgtttactaa

DBGET integrated database retrieval system