KEGG   Nelumbo nucifera (sacred lotus): 104613429Help
Entry
104613429         CDS       T04131                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00480  Glutathione metabolism
nnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104613429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nnu02000]
    104613429
Enzymes [BR:nnu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104613429
Transporters [BR:nnu02000]
 Other transporters
  Pores ion channels [TC:1]
   104613429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_N_4 GST_C_3
Motif
Other DBs
NCBI-GeneID: 104613429
NCBI-ProteinID: XP_010279540
UniProt: A0A1U8BDM1
Position
Un
AA seq 227 aa AA seqDB search
MAEEVKLIGAWISPFSLRVELALKLKGVQYEYIDEDLSNKSPLLLKYNPIHKKVPVLLHN
GKPIAESTVILEYIDETWKGYHLLPEDPYERAMTRFWVKFIDEKCIEAIWKACWIEERKQ
EKAIEEAKETLKILENELKKGRKFFAGDNIGFVDIAAIFIAFWVGVLQEVVGISLMDEEK
FPVLHKWIEEFINCDVVGENLPPRDKLFAYYQGHKETIYAIASRFYK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagaagtgaagttgattggcgcatggataagcccttttagtctcagagtagag
cttgctctgaaactgaagggggtgcaatatgaatacatagatgaagatctctctaacaag
agtcctttgcttctgaaatacaaccctattcataagaaggtccctgtgctgttacacaat
ggaaagccaattgctgaatcgacagttatacttgaatacatcgatgagacgtggaaaggc
tatcatttgttgcctgaagatccttatgagagagccatgacccgtttctgggtcaaattc
atagatgagaagtgtattgaagcaatatggaaggcttgttggattgaagaaaggaagcaa
gagaaggctattgaagaggcaaaggagactctgaaaatactagaaaatgagctcaagaag
gggaggaagttctttgcgggagataacataggatttgtagacattgctgctatctttata
gctttctgggttggagtccttcaagaagtagtgggaataagcttgatggatgaggagaaa
tttcctgtcttacacaaatggattgaggagttcatcaattgcgatgttgtcggggaaaat
cttcctcccagggataaattgtttgcttactaccaaggtcataaggaaaccatatatgca
atcgcgtctaggttttataaatga

DBGET integrated database retrieval system