KEGG   Nelumbo nucifera (sacred lotus): 10743890Help
Entry
10743890          CDS       T04131                                 

Gene name
rbcL, N623_p057
Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nnu  Nelumbo nucifera (sacred lotus)
Pathway
nnu00630  Glyoxylate and dicarboxylate metabolism
nnu00710  Carbon fixation in photosynthetic organisms
nnu01100  Metabolic pathways
nnu01110  Biosynthesis of secondary metabolites
nnu01200  Carbon metabolism
Module
nnu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nnu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
nnu_M00532  Photorespiration
nnu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    10743890 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    10743890 (rbcL)
Enzymes [BR:nnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     10743890 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 10743890
NCBI-ProteinID: YP_009093958
UniProt: D3WC82
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEESQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGIHFRVLAKALRMSGGDHIHSGTVVGKLEGEREITLGFVDLLRDDFIEKDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEVWKEIKFEFEAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagattac
agattgacttattatactcctgaatatgaaaccaaagatactgatatcttggcagcattc
cgagtaactcctcaacctggagttccacctgaggaagcaggggccgcggtagctgccgaa
tcttctactggtacatggacaactgtgtggaccgatggacttaccagccttgatcgttac
aaaggacgatgctaccacatcgagcccgttgctggagaagaaagtcaatttattgcttat
gtagcttaccctttagacctttttgaagaaggttctgttactaacatgtttacttccatt
gtgggtaatgtatttgggttcaaagccctacgtgctctacgtctggaggatctgcgaatc
cctcctgcttattctaaaactttccaaggcccacctcatggtatccaagttgagagagat
aaattgaacaagtatggtcgtcccctattgggatgtactattaaaccaaaattggggtta
tccgctaagaactacggtagagcggtttatgaatgtctacgtggtggacttgattttacc
aaggatgatgagaacgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagcaatttacaaagcacaagccgaaacaggcgaaatcaaaggacattacttg
aatgctactgcaggtacatgtgaagaaatgatcaaaagggctgtatttgccagagaattg
ggagttcctatcgtaatgcacgactacttaacggggggattcactgcaaatactagcttg
gctcattattgccgagataatggcctacttcttcacatccaccgtgcaatgcatgcagtt
attgatagacagaaaaatcatggtatacactttcgtgtactagctaaagcgttacgtatg
tctggtggagatcatattcactctggtacagtagtaggtaaacttgaaggggaaagagaa
atcaccttgggctttgttgatttactacgtgatgattttattgaaaaagaccgaagtcgc
ggtatttatttcactcaagattgggtctctctaccaggtgttctgcccgtggcttcaggg
ggtattcacgtttggcatatgcctgctctgaccgagatctttggggatgattccgtacta
cagtttggtggaggaactttaggacacccttggggaaatgcaccgggtgccgtagctaat
cgagtagccctagaagcgtgtgtacaagctcgtaatgagggacgtgatcttgctcgtgaa
ggtaatgaaattatccgtgaggctagcaaatggagccctgaactagctgctgcttgtgag
gtatggaaggagatcaaattcgaattcgaagcaatggatactttgtaa

DBGET integrated database retrieval system