KEGG   Nonomuraea sp. ATCC 55076: BKM31_01675Help
Entry
BKM31_01675       CDS       T04759                                 

Definition
(GenBank) nitrilase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
noa  Nonomuraea sp. ATCC 55076
Brite
KEGG Orthology (KO) [BR:noa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKM31_01675
Enzymes [BR:noa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BKM31_01675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AQZ60395
UniProt: A0A1U9ZR25
Position
complement(368926..369702)
Genome map
AA seq 258 aa AA seqDB search
MTRIALCQIPVSPDPAANLKRVREALASAEGADLAIFPEATLTRYGRRITTLAEPLDGPF
VSGLADAAREHGLAVIAGVFEPGDDRVHNTAVAIDARGELKAAYRKIHLFDSFGAKESDL
VAPGAEPAVVELAGLRVGLITCYDVRFPELARALVDKGAELFAVIAAWGSGPLKEDHWVT
LVRARALENTMWTAAVGQAPNPAESSDGFGVGRSMLVDPLGVVRSDLGTGPGVRVVEVDR
EWTATARAMLPCLEHRVL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagaatcgccctctgccagatcccggtctcccctgaccccgccgccaatctgaag
agggtcagggaggcgctcgcgtccgccgagggcgccgacctggcgatcttccccgaggcc
acgctcacccgctacggccggcgcatcaccacgctggccgagccgctcgacgggccgttc
gtgtccgggctggccgacgcggcccgcgagcacgggctggcggtgatcgcgggcgtgttc
gagcccggcgacgaccgggtgcacaacaccgccgtcgcgatcgacgcccggggcgagctg
aaggcggcctaccggaagatccacctgttcgactcgttcggcgcgaaggagtccgacctc
gtcgcgccgggcgccgagcccgccgtggtggagctggccggcctcagggtgggcctgatc
acctgctacgacgtgcgcttccccgagctggccagggcgctggtcgacaagggcgccgag
ctgttcgcggtgatcgccgcgtgggggtcgggccccctcaaggaggaccactgggtcacc
ctggtcagggcgcgggcgctggagaacaccatgtggaccgccgccgtcggccaggcgccc
aacccggcggagtcgtccgacgggttcggggtgggccgcagcatgctggtcgacccgctc
ggcgtcgtccgctccgacctgggcaccggccccggcgtgcgggtcgtcgaggtcgaccgg
gagtggacggccaccgccagggcgatgctgccctgcctcgaacaccgcgtgctgtga

DBGET integrated database retrieval system