KEGG   Nonomuraea sp. ATCC 55076: BKM31_01945Help
Entry
BKM31_01945       CDS       T04759                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
noa00480  Glutathione metabolism
noa00590  Arachidonic acid metabolism
noa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:noa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BKM31_01945
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKM31_01945
Enzymes [BR:noa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BKM31_01945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: AQZ60441
UniProt: A0A1U9ZR63
Position
422609..423094
Genome map
AA seq 161 aa AA seqDB search
MSLSDIPLRTLSDEPTTLAELTGGKPALIVNVASRCGLTPQYTGLVKLQEQYGPRGFTVI
GMPCNQFGGQEPGTAKEIQHFCSTTYGVDFPLLEKAEVNGPGRHPLYAELTSTPDEQGEA
GDVQWNFEKFLIDGQGRVVARFRPRTAPEDPAITSAIEKLL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcagcgacatcccgcttcgcaccctctcggacgagccgaccacgctcgccgag
ctgaccggcggcaagcccgccctcatcgtgaacgtggcctccagatgcgggctcaccccg
cagtacaccggcctggtcaagctccaggagcagtacggcccgcgcggcttcaccgtgatc
ggcatgccctgcaaccagttcggcggccaggagcccggcacggccaaggagatccagcac
ttctgctccaccacgtacggcgtggacttcccgctgctggagaaggccgaggtcaacggc
cccggccggcacccgctctacgccgagctcacgagcacgcccgacgagcagggcgaggcg
ggcgacgtccagtggaacttcgagaagttcctgatcgacgggcaggggcgggtcgtcgcc
cgcttccgcccccgaaccgcccccgaagacccggcgatcacctcggccatcgagaaactg
ctctaa

DBGET integrated database retrieval system