KEGG   Nonomuraea sp. ATCC 55076: BKM31_30160Help
Entry
BKM31_30160       CDS       T04759                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
noa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:noa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BKM31_30160
Enzymes [BR:noa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BKM31_30160
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BKM31_30160
    1.1.1.-  
     BKM31_30160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 F420_oxidored 2-Hacid_dh_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AQZ65140
UniProt: A0A1V0A4K3
Position
complement(6748511..6749548)
Genome map
AA seq 345 aa AA seqDB search
MRAAVWYGAGDVRVEDVPEAPPGPGEVTIDVAYCGICGSDLHEYADGPHAIPVGEPHPES
GVAAPLVLGHEFCGTVRAAGAGVTGLAPGDRVAVEPHYRCGSCPRCRAGEYNICRHFGFA
GLMGHGGLAERATVPAYMLHRLPDAVSLEQAAVFEPAAVALHAVRRAGIRPGESVAVLGL
GPIGLLVTRLAARCGAGRIVAADRSPARRELALRMGAAATGADLAEVTEGEGVDVAFEAA
GSPDTLRACLAATRRGGRVMLLGLTGTITLDAFALVNNEQTIMTSVGYRDAYPELTRMVA
EEGVDLAGIVTSTIPLDHVVRDGFDALLRGEEQVKVLVRPTGRRP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagggcggcggtctggtacggggcgggggacgtccgggtcgaggacgtgccggaggcg
ccgcccgggcccggcgaggtcacgatcgacgtggcgtactgcgggatctgcggcagcgac
ctgcacgagtacgccgacggcccgcacgcgatccccgtcggcgagccgcaccccgagtcg
ggcgtggccgcaccgctcgtcctggggcacgagttctgcggcaccgtgcgcgcggccggc
gccggcgtcaccgggctggcccccggcgaccgggtggcggtggagccgcactaccggtgc
gggagctgcccgcgctgccgggcgggggagtacaacatctgccggcacttcgggttcgcc
gggctcatggggcacggcgggctggccgagcgcgccacggtgcccgcgtacatgctgcac
cggttgccggacgcggtctccctggagcaggcggcggtgttcgagccggccgccgtggcg
ctgcacgcggtgcgccgggccgggatccggcccggcgagagcgtcgccgtcctcggcctg
ggcccgatcgggctgctcgtgacccggctcgcggcccggtgcggcgccgggcggatcgtg
gccgccgaccggtcaccggcccgccgcgagctggccctgcggatgggcgccgccgcgacc
ggcgcggacctcgccgaggtgacggagggcgagggggtggatgtcgcgttcgaggcggcc
ggctcgccggacacgctgcgggcctgcctggccgcgacccggcgcggcggccgcgtgatg
ctcctcggcctgaccggcacgatcacgctggacgcgttcgccctggtgaacaacgagcag
acgatcatgaccagcgtcgggtaccgcgacgcctaccccgagctgacgcgcatggtggcc
gaggagggcgtggacctggccggcatcgtcacctccaccatccccctcgaccacgtcgta
cgtgacgggttcgacgcgctgctgcgcggagaggagcaggtcaaagtgctggtacgaccg
acggggcggcggccgtga

DBGET integrated database retrieval system