KEGG   Nonomuraea sp. ATCC 55076: BKM31_56545Help
Entry
BKM31_56545       CDS       T04759                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
noa  Nonomuraea sp. ATCC 55076
Pathway
noa00860  Porphyrin and chlorophyll metabolism
noa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:noa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BKM31_56545
Enzymes [BR:noa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     BKM31_56545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase SNO DJ-1_PfpI Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AQZ69643
UniProt: A0A1V0AHH2
Position
complement(12565815..12567302)
Genome map
AA seq 495 aa AA seqDB search
MVKGALLVAGTTSDAGKSVVTAGICRWLARQGVSVAPYKAQNMSLNSYVTADGAEIGRAQ
AMQAQACGLEPVADMNPILLKPGSDRRSQVVLMGRPVADVDAMEYGALKDLLRTSALEAL
ERLRARYDVVVCEGAGSPAEINLRRGDIANMGLARAANLPVIVVGDIDRGGVFAAFYGTV
GLLDAADQAHVAGFVVNKFRGAKELLEPGLDMIRQLTGRAVYGVLPWLDGLWLDVEDSLA
LDSRHVPLRAPYGRQTLRVAVVRLPRISNFTDVDALAAEPGVVVRFATDPVELDDADLVV
LPGSRATVSDLAWLRESGLAAAISARKGPVLGICGGFQMLAEEIVDEVESGAGRVEGLGV
LPVRVTFGREKRLARPEGTAYGQPVRAYEIHHGVATVEGGEPFLDGCRVGDVWGTTWHGA
LENDGFRRAFLADVAARAGRDFVPDPATDFAGLRERRLDALGDLVEQHLDTDALLRLIDQ
GPPATLPALPPGTVQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagggggcattgctggtcgcgggcaccacatccgacgcgggcaagagcgtggtc
acggcgggcatctgccgctggctggcccgccagggcgtcagcgtggcgccctacaaggcg
cagaacatgtcgctgaactcgtacgtcaccgccgacggcgccgagatcggccgcgcccag
gccatgcaggcgcaggcatgcggcctcgaacccgtcgccgacatgaacccgatcctcctc
aaaccgggcagcgaccgccgcagccaggtcgtcctcatgggccgcccggtggcggacgtg
gacgccatggagtacggcgcgctcaaggacctgctgcgcacctcggccctggaggcgctg
gagcggctgcgcgcccgctacgacgtggtggtgtgcgagggcgcgggcagccccgccgag
atcaacctgcgccgcggcgacatcgccaacatgggcctggccagggccgcgaacctgccg
gtcatcgtggtcggcgacatcgacaggggcggggtgttcgccgcgttctacggcacggtg
ggcctgctggacgccgccgaccaggcgcacgtggccgggttcgtggtcaacaagttcagg
ggcgcgaaggagctgctggagccggggctcgacatgatcaggcagctgaccgggcgggcc
gtgtacggggtgctgccctggctcgacgggctctggctcgacgtcgaggactcactggcg
ctcgacagccgccacgtccccctgcgcgccccgtacggccggcagaccctgcgggtggcg
gtcgtgcggctgcccaggatctccaacttcaccgacgtggacgcgctggccgccgagccg
ggcgtcgtggtgcggttcgccaccgacccggtcgagctggacgacgccgacctggtcgtg
ctgcccggctcccgcgccaccgtctccgacctggcctggctgcgcgagagcggcctcgcg
gcggccatcagcgccaggaaggggccggtcctggggatctgcggcgggttccagatgctg
gccgaggagatcgtggacgaggtcgagtcgggcgcgggccgcgtcgaggggctgggcgtc
ctgccggtacgggtgacgttcgggcgggagaagcggctggccaggcccgaggggacggcc
tacgggcagccggtgcgggcctacgagatccaccacggggtggccacggtcgaagggggc
gagccgttcctcgacggctgccgggtgggcgacgtctggggcaccacgtggcacggcgcc
ctggagaacgacggcttccgccgcgccttcctcgccgacgtggcggcgcgggccgggcgc
gacttcgtccccgacccggccaccgacttcgcggggctgcgcgagcggcggctcgacgcg
ctcggcgacctggtcgagcagcatctcgacacggacgcgctgctccgcctcatcgaccag
ggcccgcccgcgaccctgcccgccctgccgcccggaaccgtgcagtga

DBGET integrated database retrieval system