KEGG   Nonomuraea sp. ATCC 55076: BKM31_56960Help
Entry
BKM31_56960       CDS       T04759                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
noa  Nonomuraea sp. ATCC 55076
Brite
KEGG Orthology (KO) [BR:noa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BKM31_56960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AQZ71404
UniProt: A0A1V0AMF6
Position
complement(12658860..12659810)
Genome map
AA seq 316 aa AA seqDB search
MDTVVLIVAAGLFAVVAGINDGGALLATGLKLPAIRPMTGIVVLTVLVAAVPLVTHQVAL
TFVTRLGSYRDPGGQFAMIIAVVSALAVVGVLSAKGRPTSLTLAVVGGLTGAGLGWGLQV
SGEWVALVLAFGLAAPFAGGLLAWVLIRVLVATTTARGLWRWHWAGFLLQTLAYAANDAQ
KMLAVFMIAVGFTGAPVEYTALAAVLFAAGTLYGLPKAGRTLGREIIVSRPPHGVAAELA
AGAAVIGCAAVGMPVSMTQAIAGGLIGAGVAQGGGRVRWYAAGKIVAAWLLTLPASGLLG
WGLALLVKGFASVRLS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttggacactgtcgtgctgatcgtggcggccggcctgttcgccgtcgtagccgggatcaac
gacgggggcgcgctcctcgcgaccgggctcaagctgcccgcgatccgcccgatgaccggg
atcgtggtgctgaccgtgctcgtggcggcggtgccgctggtcacccaccaggtggcgctg
acgttcgtgacccggctcggctcctacagagacccaggcggccagttcgcgatgatcatc
gcggtggtctccgcgctcgccgtggtcggcgtgctcagcgcgaagggccgcccgaccagc
ctgaccctggccgtcgtcggcggcctcaccggggcggggctgggctgggggctgcaggtg
tcgggcgagtgggtcgcgctggtgctggcgttcgggctggccgcgccgttcgccggcggg
ctgctggcgtgggtgctcatccgggtgctggtcgccacgaccaccgcacgcgggttgtgg
cgctggcactgggcgggcttcctgctccagacgctcgcgtacgccgccaacgacgcccag
aagatgctggccgtgttcatgatcgcggtcgggttcaccggggctccggtcgagtacacg
gcgctcgcggccgtgctgttcgccgccggcaccctgtacgggctgcccaaggccggccgc
accctcggccgcgagatcatcgtctcccggcccccgcacggcgtcgcggcggagctggcc
gccggcgcggccgtgatcggctgcgcggccgtcggcatgcccgtgagcatgacgcaggcc
atcgccggcggcctcatcggcgcgggcgtcgcccagggcggcggccgggtccgctggtac
gccgccggcaagatcgtcgccgcctggctgctgacgctgcccgccagcggcctgctcggc
tgggggctcgccctgctggtgaaggggttcgcgagcgtgagactgtcatga

DBGET integrated database retrieval system