KEGG   Nitrosococcus oceani: Noc_0333Help
Entry
Noc_0333          CDS       T00281                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
noc  Nitrosococcus oceani
Pathway
noc00630  Glyoxylate and dicarboxylate metabolism
noc00710  Carbon fixation in photosynthetic organisms
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01200  Carbon metabolism
Module
noc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:noc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Noc_0333
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Noc_0333
Enzymes [BR:noc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Noc_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABA56859
UniProt: Q3JE87
Position
complement(359642..361120)
Genome map
AA seq 492 aa AA seqDB search
MGKSETIAEGKDRYQAGVIPYKKMGYWEPDYQPKDTDIIAMFRITPQPGVDPEEAAAAVA
GESSTATWTVVWTDRLTDCELYRAKAYRADLVPNTGEGTKNEAQYFAYIAYDLDLFEPGS
IANLTASIIGNVFGFKAVKALRLEDMRIPVAYLKTFQGPATGVVVERERLDKFGRPLLGA
TTKPKLGLSGRNYGRVVYEALKGGLDFVKDDENINSQPFMHWRDRFLYCMEAVNKASAAT
GEVKGHYLNVTAATMEDMYERAEFAKSLGSVIIMIDLVVGYTAIQSMAKWARKNDMILHL
HRAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLMIKGFYDTLLDSH
TPTSLEHGLFFDQDWASLNKVMPVASGGIHAGQMHQLIQYLGEDVILQFGGGTIGHPQGI
QAGAVANRVALEAMILARNEGRDYVKEGPQILQDAAKWCSPLKAALDTWKDVTFNYESTD
TADFVPTATASV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatcagaaacaatcgccgaagggaaagatcgttatcaagccggcgttatccct
tataaaaagatgggctactgggagcctgattaccaacctaaagacactgacatcatcgcg
atgttccgcatcaccccacagccgggcgtcgatcccgaggaagccgctgctgccgtggca
ggtgagtcctccaccgctacttggacggtcgtgtggacggatcgcttgaccgactgcgag
ctttaccgtgctaaagcctatcgcgcagatctggtacccaatacgggcgaagggactaaa
aacgaagcgcaatattttgcctatattgcctatgatttggatcttttcgagcctggctcc
atcgccaatttgacagcctctatcatcggcaacgtcttcggcttcaaggcggtaaaagcc
ctgcgcctagaagacatgcgtatcccagttgcctacctgaaaacctttcagggaccagct
accggggtcgtggtggagcgggaacgcctagataaatttggccgccccctgctcggcgcc
accaccaagcctaaactcggcctttccggccgcaattacggccgggtagtctatgaggcc
ctgaaaggcggtctcgacttcgtcaaggacgatgagaacatcaactcccagccgttcatg
cactggcgcgatcggttcctctattgcatggaagcggttaacaaggcatccgcggctacc
ggcgaagtcaagggccattacctcaacgtgaccgccgctaccatggaagacatgtacgag
cgggctgagtttgctaaatccctcggctcagtcatcatcatgattgacttggtggtgggt
tataccgcgattcagtccatggccaagtgggcccgcaagaacgatatgatcttgcatctc
catcgcgctggtaattcgacctattcccggcagaagaatcacggcatgaacttccgtgta
atttgtaagtggatgcgcatggccggggtcgatcatatccatgctggtaccgtggtcggc
aagctggaaggcgatccgctcatgatcaagggtttctacgataccctccttgattcacac
acgccgacaagcctcgagcatgggttattcttcgatcaggattgggcatccttgaataaa
gtgatgccggttgcctctggtggtattcacgccggtcagatgcaccaactcattcaatac
ctgggcgaggatgtaatactacaattcggtggtggcaccatcggccatccacagggtatc
caagcgggtgcagttgctaaccgcgtcgctctggaagccatgatcttggcgcgtaatgaa
ggccgtgattatgtgaaggaaggtcctcaaatcctccaggatgccgccaagtggtgttcg
cccctcaaggccgccctggacacctggaaggatgtgaccttcaattatgaatcgaccgat
acggccgacttcgtgccaacggccacagccagcgtttaa

DBGET integrated database retrieval system