KEGG   Nitrosococcus oceani: Noc_0628
Entry
Noc_0628          CDS       T00281                                 

Definition
(GenBank) PilL protein
Organism
noc  Nitrosococcus oceani
SSDB
Other DBs
NCBI-ProteinID: ABA57147
UniProt: Q3JDE9
Position
675757..676251
AA seq 164 aa
MSSSKHHPMSQLLRILLCCSAAAVTSHSAVAKERPVTAISTLTQIDRYSVIAVRPTAGQR
DLLSVTRAITIPDDIESVGEAFHWMLRDSGYRLATDTVLSEESAAMLELPLPAVHRRFEP
MPLQTVMGLMIGPAFHLIQDPVHRLIAFERCADSPDPNATGGAQ
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcttcgtccaaacatcaccccatgtcacagctcttgaggatactgttgtgttgttct
gcggcagccgtcacgagccattcagcagtggcgaaggagcggcccgtcacagcaatcagc
actctgactcaaattgatcgctattcagtgatagcggttcggccgaccgccgggcagcgg
gatctgctatcggtgacgagggcgatcactattcccgacgacatcgaaagtgtgggggaa
gccttccactggatgttgcgagattccggctatcgcctggcgaccgataccgtgctgtcg
gaggagtcggcagccatgctggagctgccgctgccggccgtgcaccgccgctttgaaccc
atgccgctgcaaactgtgatgggactcatgattggtcctgcttttcaccttatccaggat
cccgttcaccgcctcattgccttcgagcgttgcgcggatagtccagaccccaatgcaacg
ggaggtgcgcagtaa

DBGET integrated database retrieval system