KEGG   Nitrosococcus oceani: Noc_0629
Entry
Noc_0629          CDS       T00281                                 
Name
(GenBank) hypothetical protein
Organism
noc  Nitrosococcus oceani
SSDB
Motif
Pfam: AhpC-TSA Glrx-like DUF899 Prp18
Other DBs
NCBI-ProteinID: ABA57148
UniProt: Q3JDE8
Position
676468..677286
AA seq 272 aa
MSTERRAGKPCVGFVGFCLCLTLPVYADSLQTAESQSSNTPAIEQSVTERIDSLAFRANQ
WGIDESEWQRYQSLMQGVRGSVSPATLSPLEVLGIHARSADERRRYAERWAVMMRDDAER
ILAFQRAYDDAQRRLFPNGLLIDPGVVASTKPDQGLAGKFAWQSSDRVLFFTDTQCPTCD
AVLERLLSQIKHFSGIDLYLIDVSAGDESRIRDWAASKQIDPQWVSEHKITLNIDAGALN
QVANHTGQQGQDLPILILRREGRLDPLPASRF
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtccactgaacgtcgcgcgggaaagccatgcgtcggatttgtcgggttctgtctatgc
cttacgttgcccgtttacgcggatagccttcagacagcggaatcgcaatcttcgaacaca
ccggcgattgagcaatccgtgacagaacgtattgactcgctggcgtttcgtgctaaccag
tgggggatagatgaatcggaatggcagcgttaccaatccctgatgcaaggtgtccggggc
agcgtgagtcctgcgaccttgtcacccctcgaagtgctgggcattcacgcgcgtagcgct
gatgaacgtcggcgctacgcagagcgatgggcggttatgatgcgagacgatgctgagcgc
attctggcgtttcagcgggcctacgacgacgcccagcggcgcttgtttcccaacggcttg
ttgatcgaccccggtgttgtagcttccactaagccggatcaaggtctggctggaaaattc
gcgtggcagtcgtctgaccgggtgttgttctttaccgatacccaatgcccgacctgcgat
gcggtgctggagcgattgttgagccagatcaaacacttctcaggcatcgatctgtacctg
atcgatgtgtccgccggggacgaatcccgtatacgcgactgggcggcctcgaaacagatc
gatccgcaatgggtcagcgagcacaagattaccctgaacattgatgcgggtgcgctcaac
caggtcgcaaaccacacggggcaacagggacaggatttaccgatactgatactacgccgg
gaagggcgattggatcccttgccggcatcacgattttaa

DBGET integrated database retrieval system