KEGG   Nitrosococcus oceani: Noc_0633
Entry
Noc_0633          CDS       T00281                                 

Definition
(GenBank) conserved hypothetical protein
Organism
noc  Nitrosococcus oceani
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: ABA57152
UniProt: Q3JDE4
Position
680571..681302
AA seq 243 aa
MAEPTDPRRPVTRPGTFSRVLTGLAQCLKWLFLSLIFSVLIEWIGMVFWWEEQGLDHSRQ
MLVNELQFLGADFHRSWLTAHPMQFASDLSDRFYHIAFEWTGIVDLIQWITPAPGLEESG
VRPVLHRFYRPVADYVLAGMQITQVFAVRLAILTLATPVFGLFTLVALVDGLVRRDLRRW
GGGRESSFVYHYAKKAAIPLIIMAWVLYLALPFSLHPSWIILPFALAFAFAVTITASTFK
KYL
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcggaaccgacggatccccgccgacccgtcacgcgccccggcacattctcccgggtt
ttgacagggctagcccagtgtcttaagtggctgtttctctcactgatattttccgttctg
attgaatggatcggcatggtgttctggtgggaggagcaggggctggatcacagccgacag
atgctggtgaacgagttgcagttcctcggcgcagactttcaccgcagctggttaacggct
catcccatgcaattcgccagtgatttgtccgaccggttttaccatatcgcctttgagtgg
accggtattgtcgatcttatccagtggattacgccggccccgggccttgaagagtccggc
gtgcgcccggtgctgcaccggttttaccggccagttgctgactatgtcctggccggtatg
caaatcacgcaggtttttgcggtacgtctcgccatcctgacgctggcgacgccggtattt
ggactgttcaccctggtggcactggttgatggtctggtgcggcgggacctgcggcgttgg
ggcggcggcagggaaagctctttcgtctatcactatgccaagaaagccgccataccgctg
atcatcatggcctgggtgctgtacctggcgctaccgttcagtttgcacccgtcctggatc
atcttgccgttcgctctggcctttgcctttgctgtgaccatcacggccagtaccttcaaa
aagtatctctga

DBGET integrated database retrieval system