KEGG   Nitrosococcus oceani: Noc_0640
Entry
Noc_0640          CDS       T00281                                 

Definition
(GenBank) conserved hypothetical protein
Organism
noc  Nitrosococcus oceani
SSDB
Motif
Pfam: Plasmid_RAQPRD DUF5771
Other DBs
NCBI-ProteinID: ABA57159
UniProt: Q3JDD7
Position
690133..690435
AA seq 100 aa
MKRQFWPSTFLILGLCVAPAAFADADAEREALAKIIHELNALETLINRAEVNADRDSRIR
FRYDWLRQDLKQIKDGIQSHIDSPRAQPRSFPPLRGDYRR
NT seq 303 nt   +upstreamnt  +downstreamnt
atgaaacgccaattctggccatcaacttttctgattctaggcttgtgcgtcgcgccggcg
gcgttcgctgatgcagacgcggagcgtgaggcgctggcgaaaatcatccatgagctcaat
gccctcgagacgctaatcaatcgcgctgaggtcaatgctgatcgggattcccgtatccga
tttcgttatgactggctgcgtcaggatctgaagcagatcaaggacggcatccagtcacac
atcgattccccccgcgcgcagcctcgctcatttccgccattgcgcggcgattaccgtcga
tag

DBGET integrated database retrieval system