KEGG   Nitrosococcus oceani: Noc_0643Help
Entry
Noc_0643          CDS       T00281                                 

Definition
(GenBank) putative membrane protein
Organism
noc  Nitrosococcus oceani
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3487 PrgI DUF2207
Motif
Other DBs
NCBI-ProteinID: ABA57162
UniProt: Q3JDD4
Position
691192..691572
Genome map
AA seq 126 aa AA seqDB search
MSNDHETLADRLNAEPAIFKGCSSSELGMIVGFAIVVWLPLSLLLAWLLGAITMGFGIAG
VGVVATVVVMATLFQRIKRGRPEGYYQQWLRIRLQTMGLYRTPWVLRSGSWDIGRTHYAP
LPTRNR
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaccatgaaactctggcggatcggctcaatgccgagcccgccatctttaaa
ggctgctcatcctctgagctcggcatgattgtggggtttgccatcgtggtatggctgccc
ctcagtctcttactggcctggttgctgggggcaatcactatgggctttggtatcgccggt
gtcggtgtggtggccaccgtcgtggttatggcgacgttgtttcagcgtatcaaacgcggg
cggcctgagggctattaccaacaatggctacgtattcgtttgcaaacgatggggctgtat
cgcacgccctgggtattacgtagcgggtcctgggacattgggagaacgcactatgcgccg
ctaccgactcgaaatcgataa

DBGET integrated database retrieval system