KEGG   Nitrosococcus oceani: Noc_0645
Entry
Noc_0645          CDS       T00281                                 

Definition
(GenBank) conserved hypothetical protein
Organism
noc  Nitrosococcus oceani
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: ABA57164
UniProt: Q3JDD2
Position
692218..693042
AA seq 274 aa
MNVTDYYVPVKWIALLWSCFLGLCFPLVSFAQVDDAASNSPERIVWNKAPIAIPLVVSEE
RLVHFPDSVSIGLPQSLTPFLRSQSINGTLYLLARQPFETTRVMVRSETDGPIYVLDISA
SPSGSDSRSLPDVRILLESPQDAGAAESTSDNRSLSLGYATLTRYAAQQLYAPTRLIPHQ
SGVVAMPVNAEPVDLVHGAKVEAVPVAAWKVGLKYVTAVKLTNRTQRPLVLDPRELRGSW
LAATFQHNRLLPAGNAADTTAVYLVSDRPFDVAL
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaatgtcactgattactacgttccagtgaaatggattgccctgctctggtcctgtttt
ctcgggttatgttttcccttggtctcctttgcgcaagtcgatgacgcggcatcgaacagt
cctgaaagaattgtctggaacaaagcgcctattgccatcccactggtcgtcagtgaagag
cgccttgtgcattttccggattcggtgagcatcggtttgccgcagtcactgacaccgttt
ctgcgcagccaaagcatcaatggcaccttatacctgttggccagacaaccctttgagacc
acccgtgtcatggtgcgctcggaaaccgatggcccgatttacgtcctcgatatttcagcg
tcaccaagcggatcagacagtcgctcattgcctgatgtgcggatactgctggagtcaccg
caagacgccggtgccgctgagtcgacatctgacaatcgatcactgtctttgggttatgcc
acgttaacccgttatgccgctcaacaactctacgcgccaacgcgactgatcccgcatcag
tcgggtgtggttgccatgccggtaaatgccgagccggtcgatctggtgcatggcgcaaag
gttgaagccgtgccggtcgccgcgtggaaggtggggctgaagtacgttactgccgtaaaa
ctcaccaatcgcactcaaagaccgcttgtgctggatccgcgcgaactgcgcgggtcatgg
ctggctgcgacgtttcagcacaatcgcctgttaccagccggcaatgcggccgataccacg
gccgtctatctggtatcagatcggcccttcgatgtggcgctttga

DBGET integrated database retrieval system