KEGG   Nitrosococcus oceani: Noc_0646
Entry
Noc_0646          CDS       T00281                                 
Name
(GenBank) conserved hypothetical protein
Organism
noc  Nitrosococcus oceani
SSDB
Motif
Pfam: TMF_TATA_bd ZapB CENP-H DivIC Allexi_40kDa YabA
Other DBs
NCBI-ProteinID: ABA57165
UniProt: Q3JDD1
Position
693062..694483
AA seq 473 aa
MSMVTSNRLLPLLAGSVVLMAVLVAVKSCSPNEEQPQLLEAVPQAPKPDADTPADTIKTL
TANVSAMTSELNALRRDNTALKQENRDLIKDRKQIENNVLSRVQTALETKRMDAAPTETT
SAIAALTARVDSLTNRFGTSSTRPSSTGSDIPIGLGLDGIGTSAAESESLVWVNPLEFTP
SPDGDKETLLNRFSRTSRNALDGTRPEVQSLVAKGSDALNTALPVYTVPRNATLIGSTGM
TALVGRVPIQGQVRDPMPFKVITGKENLAANGLRIPGVEGMIWSGTAIGDWTLSCVTGKL
ESVTFVFEDGTIQTLSSDENQLGGSSGNSDRPLGWISDARGIPCITGERKTNAPAFLAQR
IGVMALQAAGEAAAQSETTTLISDSGTATSVVSGETGKYVLGKTLGGGSDEVAQWLRERQ
AQSFDAVFVPAGIELAIHVDHELPIDFHSNGRKLHHETNLFEHATITTGSGLD
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtcgatggtcaccagtaatcgtttgttacctcttcttgccggctccgttgtgctgatg
gcagtgctagttgcagtgaagtcctgctccccgaatgaggagcaacctcagcttttggaa
gccgtgccacaagcgccgaaaccggatgccgatacacccgcagacaccatcaagaccctg
acggcgaatgtcagcgccatgacctcggaactcaatgccctgcgtcgggataacaccgcg
ctcaaacaggagaatcgcgatctgatcaaagacagaaagcagatagaaaacaacgtgctg
tcgagagtgcagacagcattggagacaaagcgcatggacgcagcccccaccgaaaccacg
tcagccatcgctgcgctgacggcgagggtggattcgctgactaaccggtttggaacttca
tctacacggccgtcttctacgggttctgatattccgatcggactcggtctggatggcatt
ggaacatcggccgcggaatcggaatcactggtgtgggtcaatcccctggagttcacacca
tcgcctgacggtgataaggagacgttgctcaaccgcttcagtcgcaccagtcgtaatgcg
ttagatggcactcgtccggaagtgcaatcgcttgtggcgaaaggttccgatgccctcaat
accgcactgccggtctacaccgtgccgcgcaatgccacgctgattggatccactggcatg
accgcattggtgggcagggtgcctatccaggggcaggtccgcgaccccatgccgttcaag
gtgattaccggcaaggaaaacctcgccgccaatggtctgcgcatcccaggcgtcgaaggc
atgatctggagtggcacggcgatcggtgattggacgctctcctgcgtgaccgggaaattg
gaatcggtgacctttgttttcgaggacggcaccatccagaccttgtccagtgacgagaat
cagttgggtggttccagtggaaacagcgatagacccctgggttggatttccgatgcgcgg
ggtattccctgtatcacgggtgagcgcaagaccaacgcaccggcgttcctggcacagcgc
attggagtgatggcgctccaggctgccggtgaagctgcggcgcagtccgaaaccacaacc
ctgatcagcgactcgggtaccgccaccagcgtggtctcgggtgagacgggcaaatacgtc
ttgggtaaaacattaggcgggggcagcgacgaagtcgctcagtggttgcgggagcgtcag
gctcagagcttcgatgcggtatttgtgcccgcgggtatcgagctggcgatccatgtcgat
catgaactccccattgatttccattccaacggcaggaaactccatcatgaaacgaatctt
tttgaacacgcaacgattaccactggttctggtctggactag

DBGET integrated database retrieval system