KEGG   Nitrosococcus oceani: Noc_0647
Entry
Noc_0647          CDS       T00281                                 

Definition
(GenBank) conserved hypothetical protein
Organism
noc  Nitrosococcus oceani
SSDB
Motif
Pfam: tRNA-Thr_ED
Other DBs
NCBI-ProteinID: ABA57166
UniProt: Q3JDD0
Position
694485..694886
AA seq 133 aa
MLMVGCASTKESVLPQDGPTMKSIYDQHMVDVQQSGHRRTIGGQPLPQSGIDHYRGFVRE
AANEIDTVFPRLPNPTLVMYIFPHLSGSERTPVPGYVTTFPFYERVEYALPGEVPGEVPG
EVPAPIVPSPDEQ
NT seq 402 nt   +upstreamnt  +downstreamnt
gtgctgatggtcggctgcgccagcaccaaggagtcggtgttgccgcaggacggtcccacc
atgaagtccatctacgaccagcacatggttgatgttcagcagtctggccatcgtcgaact
atcggtggtcagccgttaccgcaatccggtatcgaccactaccggggctttgtgcgagag
gccgctaatgaaatcgacacggtatttccccgcctgccaaatcccaccctggtgatgtat
atctttcctcatctatcgggcagtgaacgcacgccggtaccgggctatgtcaccaccttt
cccttttacgagagggtggagtacgccttaccgggagaagtgccgggggaagtgcccggt
gaggtgccggcaccgatcgtaccttcgcccgacgagcagtag

DBGET integrated database retrieval system