KEGG   Nitrosococcus oceani: Noc_0714Help
Entry
Noc_0714          CDS       T00281                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
noc  Nitrosococcus oceani
Pathway
noc00020  Citrate cycle (TCA cycle)
noc00640  Propanoate metabolism
noc00660  C5-Branched dibasic acid metabolism
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
Module
noc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
noc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:noc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Noc_0714
   00640 Propanoate metabolism
    Noc_0714
   00660 C5-Branched dibasic acid metabolism
    Noc_0714
Enzymes [BR:noc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Noc_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ABA57228
UniProt: Q3JD68
Position
772638..773513
Genome map
AA seq 291 aa AA seqDB search
MSILVDKQTRVICQGFTGKQGTFHSRQALEYGTQLVGGVTPGKGGQTHLGQPVFNTVAEA
VEATGANATMIYVPAAFAADAILEAADGGVPLIVCITEGIPVLDMLRVKAALAGLPSYLV
GPNCPGIITPGACKIGIMPGDIHQAGRIGIVSRSGTLTYEAVYQTSRKGLGQSTCVGIGG
DPIQGMSFVDCLTLFEQDPQTEGVILVGEIGGSAEEEAAEYIQHHVSKPVVAYIAGLTAP
KGKRMGHAGAIISGGKGTAEGKLKALSAAGVSIAHSPAEMGECMEQAMGDR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcttggttgataagcagacacgggtcatttgccaaggttttacgggtaagcaa
ggcactttccattcccggcaagccttagagtatggcacgcagctggtgggcggcgtaacg
ccaggcaagggagggcagacgcatctagggcagcctgtattcaacacggtagcggaggcg
gtagaggcgaccggcgctaacgccaccatgatctatgttcccgcagcttttgccgccgat
gctattttagaggccgcggatgggggagtcccccttatcgtgtgtattaccgaggggatt
cccgttcttgatatgctcagggttaaagccgctctggcaggtctcccatcctatctagta
ggacctaattgccctggtattattactcccggggcttgtaaaatcggtattatgccaggc
gatattcatcaagcgggccggattggcatcgtttcccgctcaggcacccttacctatgag
gcagtctatcaaacgagccgaaaagggctgggtcaaagtacctgtgtggggattggaggg
gatcctatccaaggtatgagctttgtcgattgcctgactctttttgagcaagatccccag
actgagggggtgattctagtgggtgaaataggtggcagtgctgaagaagaagccgccgaa
tatattcagcatcatgttagcaaacctgttgttgcctatatcgcggggttgacggccccc
aagggcaaacgtatgggacatgctggcgccattatcagtggtggtaagggaacggcggaa
ggtaagttgaaagcattatccgcggcgggtgtgtctattgctcattcaccggccgagatg
ggagagtgtatggaacaggccatgggcgataggtaa

DBGET integrated database retrieval system