KEGG   Nitrosococcus oceani: Noc_0826Help
Entry
Noc_0826          CDS       T00281                                 

Definition
(GenBank) short chain enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
noc  Nitrosococcus oceani
Pathway
noc00071  Fatty acid degradation
noc00280  Valine, leucine and isoleucine degradation
noc00281  Geraniol degradation
noc00310  Lysine degradation
noc00362  Benzoate degradation
noc00380  Tryptophan metabolism
noc00410  beta-Alanine metabolism
noc00640  Propanoate metabolism
noc00650  Butanoate metabolism
noc00903  Limonene and pinene degradation
noc00930  Caprolactam degradation
noc01040  Biosynthesis of unsaturated fatty acids
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
noc01212  Fatty acid metabolism
Module
noc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Noc_0826
   00650 Butanoate metabolism
    Noc_0826
  Lipid metabolism
   00071 Fatty acid degradation
    Noc_0826
   01040 Biosynthesis of unsaturated fatty acids
    Noc_0826
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Noc_0826
   00310 Lysine degradation
    Noc_0826
   00380 Tryptophan metabolism
    Noc_0826
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Noc_0826
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Noc_0826
   00281 Geraniol degradation
    Noc_0826
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Noc_0826
   00930 Caprolactam degradation
    Noc_0826
Enzymes [BR:noc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Noc_0826
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Noc_0826
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Noc_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABA57339
UniProt: Q3JCV7
Position
complement(899764..901782)
Genome map
AA seq 672 aa AA seqDB search
MNNNTDWCAEKDTDDIVWLRLNQSGKNTNVLSKSVLEALDKQLVQLATENPKGLIILSDK
KQGFIAGADVTEFTALRKATEARTWIQRVHEIFNRLANLPFPTVAVIHGYCLGGGLELAL
ACRYRVAANNPETQLGLPEVKLGIHPGYGGTVRLPRLIGTLPALEMMLNGRSLSTRAAVR
LGLIDQAVPARHLQQAARAFIKKSPPPYRPPFWQRLIGQAPMRQLVTKVLRSRLEKRVNS
RHYPAPFALLELWEKQEGTIEQRLALEAESLAALLISETTNNLIRVFLLQQRLKSLGKQG
IFKPQRVHVIGAGTMGGDIAAWCALKNLHVSLQDQSPDRIAPAIKRAHGLFKKRLKSQRP
IQAAMDRLMPDPRGEGLAKADVLIEAIFENIEAKQSLFQAIEPRLKAGALLATNTSSIPL
ETLAESLSQSERLVGLHFFNPVAKMQLVEIVKGEATKAEEMARAAAFTRQIGRLPLPVKS
LPGFLVNRVLTPYLLEATRLLSEGVPGPVIDQAAIDFGMPMGPIELADTVGLDICLSVAE
RLTPPEQIPEELKIKIQQGQLGKKSGSGFYRYQGGKSVKSQPPQEYQAPEDLTDRLILSM
INEAVSSLHDRVVEDADLLDAGMIFGIGFAPFRGGPLHYVRTQGVDTMRQRLQALETRYG
TRFTPSAGWQAL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaataccgattggtgcgccgagaaagataccgatgacattgtctggctacgc
cttaatcaaagcggaaaaaataccaatgtattgtccaaatccgtactagaagcactagat
aagcaattagtccaattagctacagagaatcccaagggcctcatcatcctttccgataag
aagcaaggttttattgccggagcagatgtcactgaatttaccgcgcttcgtaaagcaacc
gaagcccgaacatggattcagcgggtccatgaaatctttaaccgcttggctaatcttcct
tttcccactgttgccgttatccatggctattgtctcggcggcgggctagaactggccctt
gcttgccgctaccgagtagcggcaaataaccctgagactcaactcgggctacccgaggtc
aagcttggaatccatcccggttatggcggtaccgtacgcctaccccgcctcatcggtacc
cttcccgctcttgagatgatgctgaatgggcgcagcctcagcacccgtgccgcagtacgt
ctgggattgattgatcaagccgtccccgctcgtcaccttcagcaggccgcccgcgccttt
ataaagaaatcgccccctccctaccgtcctcctttctggcaacgactgatagggcaggcg
ccaatgcggcagctcgtcaccaaagtattacgctcccgacttgaaaaacgggtcaactca
aggcactatcctgccccttttgctttattggagctatgggaaaagcaagaaggcaccatc
gagcagcgcctggcactcgaggccgaatcccttgccgcccttctcatcagcgaaacaacc
aacaacctcattcgggtttttctgcttcaacaacggctcaaatccctgggaaaacagggt
atctttaagcctcaacgggttcatgtgataggggctggcactatggggggagatatcgcc
gcgtggtgcgccctaaaaaaccttcatgtcagccttcaggatcaatcccccgaccgtatt
gctccagccattaagcgggcccatggattattcaagaaacgcctcaaaagccagcgtcca
atccaggcggccatggatcggctaatgcccgacccgaggggggagggactcgctaaagcc
gatgtattgattgaagctatcttcgaaaatatagaagctaagcaatccttgtttcaggcc
atcgaacctaggctaaaagcgggggctttgctggccaccaacacttccagtattccctta
gaaactttggctgaaagcttgtctcaatcagaacgcttggtagggcttcatttctttaat
cccgttgccaaaatgcagttggtcgaaatagtgaaaggagaagcaacgaaagccgaagag
atggcgcgagctgcagcttttacccgccagattggccgtctccccctgccggtaaaaagt
ctgccggggtttttggttaatcgtgtgcttaccccctacctcctagaagcaacgcggcta
ctcagtgaaggcgttcctggcccagttatcgatcaggctgctatcgattttggcatgccc
atgggccccatcgaactggcagatacggtgggtcttgatatctgcctctcggtggctgaa
agattaactcccccagagcaaatacccgaagagctgaaaatcaaaattcaacaagggcaa
cttggcaaaaaaagcgggagcggattttacagataccaaggaggaaaatcggtaaaatcc
caacctccgcaggaataccaagctcctgaagatcttactgaccgcttaattctctctatg
atcaacgaagctgtctcctccctccatgaccgggttgtggaagatgccgatttgctcgac
gcaggcatgatctttggcattggttttgcccccttccggggaggtcccctccattatgtc
cgtactcagggagtagatacaatgcggcaacggctacaagcattggaaaccagatatggt
actcgttttacccctagtgcaggatggcaggcgttataa

DBGET integrated database retrieval system