KEGG   Nitrosococcus oceani: Noc_0827Help
Entry
Noc_0827          CDS       T00281                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
noc  Nitrosococcus oceani
Pathway
noc00071  Fatty acid degradation
noc00072  Synthesis and degradation of ketone bodies
noc00280  Valine, leucine and isoleucine degradation
noc00310  Lysine degradation
noc00362  Benzoate degradation
noc00380  Tryptophan metabolism
noc00620  Pyruvate metabolism
noc00630  Glyoxylate and dicarboxylate metabolism
noc00640  Propanoate metabolism
noc00650  Butanoate metabolism
noc00900  Terpenoid backbone biosynthesis
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
noc01212  Fatty acid metabolism
noc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:noc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Noc_0827
   00630 Glyoxylate and dicarboxylate metabolism
    Noc_0827
   00640 Propanoate metabolism
    Noc_0827
   00650 Butanoate metabolism
    Noc_0827
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Noc_0827
   00072 Synthesis and degradation of ketone bodies
    Noc_0827
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Noc_0827
   00310 Lysine degradation
    Noc_0827
   00380 Tryptophan metabolism
    Noc_0827
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Noc_0827
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Noc_0827
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Noc_0827
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:noc04147]
    Noc_0827
Enzymes [BR:noc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Noc_0827
Exosome [BR:noc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Noc_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABA57340
UniProt: Q3JCV6
Position
complement(901787..903091)
Genome map
AA seq 434 aa AA seqDB search
MEQGGQRSLPRPVYIVDGARTPFLKARGKPGPFTATDLAVAAGRPLLARQPFEPEMLSEV
ILGCVMPGPDEANIARVAALRLGIQDHIPAWTVQRNCASGMQALDCAALDIANDRASLVL
AGGVEAMSHAPVLLSRPLVDWLGDWNQARNIKSRLRLLGRLRPYHLRPIIGLLRGLTDPV
VGLSMGQTAEILASRFAIDRQAMDTYALESHQRLAHAQDSGWLNEVIPMFAANGQFFEQD
DGLRRDTSIAQLNKLKPVFDRPYGLVTAGNSAQVTDGACWLLLASEQAVTQHQLPVIGRI
VDSQWAALDPAQMGLGPVHATTPLLQRHQLSLNDLDAWELNEAFATQVLACLAAWQDSGY
CRDELGLKETFGELDRKRLNVDGGAVALGHPVGASGARIVLHLLHVLKRLNGQRGIATIC
IGGGQGGAMLLERG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaggtggacaacgctccctgccccggccagtctatattgtcgatggtgctcgg
actcccttccttaaagcccgggggaaacccggtcccttcaccgcaactgacctagcagtc
gctgcgggccgtccattactcgcccgccagccctttgagcccgagatgttgagcgaggtt
atcctaggttgcgtcatgcccggtccagatgaggccaacattgcccgggtggccgcctta
cgcctaggtattcaggatcatatccccgcctggaccgtgcaacgcaattgcgcctcgggc
atgcaggcactcgattgcgcggccctggacatcgccaatgatcgtgcgagcctggtattg
gctggcggggtagaagccatgagccacgcgccggtactgctaagccggcccttagtggat
tggctaggggattggaaccaggcccgtaatattaaatcgcgtttacgcttactggggcgt
ttacgtccctaccatctgcgtcctattatcggcctattacggggcttgacggatcccgtg
gtgggactttctatgggacaaacggcggaaatccttgccagccgcttcgccatcgaccgc
caggccatggatacttatgcacttgaaagccaccagcgcttggctcacgctcaggacagt
ggctggctaaacgaagtgatcccgatgttcgccgctaatggtcagttctttgaacaggat
gacgggctacgccgggacacttcaatagcccagcttaataagctcaaaccggtttttgac
cgtccctacggcttggtgactgctggcaatagtgctcaagtcacagacggtgcttgttgg
ctactattggcttcagagcaagcggttacccagcaccaacttccggtaatagggcgcatt
gtagatagccaatgggctgccttagatcccgcccagatgggactagggcccgtgcatgcc
acaaccccgttgctgcaacgccaccaactcagcctcaatgacctggatgcctgggaattg
aacgaagcctttgctacccaggttttggcctgtttggcggcttggcaagattcaggctac
tgccgcgatgaacttggtttgaaagaaaccttcggcgaattggatcgaaaacggctcaat
gtggatggaggggctgttgctctaggccatccagtcggtgctagcggagcccgcattgta
ctgcacttgctgcatgtcttgaaacgcttaaacggccaacgcggtatcgccactatttgc
attggtggaggtcaaggtggtgctatgttactagaaagggggtaa

DBGET integrated database retrieval system