KEGG   Nitrosococcus oceani: Noc_1347Help
Entry
Noc_1347          CDS       T00281                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
noc  Nitrosococcus oceani
Pathway
noc00010  Glycolysis / Gluconeogenesis
noc00052  Galactose metabolism
noc00500  Starch and sucrose metabolism
noc00520  Amino sugar and nucleotide sugar metabolism
noc00521  Streptomycin biosynthesis
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
Module
noc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noc_1347
   00052 Galactose metabolism
    Noc_1347
   00500 Starch and sucrose metabolism
    Noc_1347
   00520 Amino sugar and nucleotide sugar metabolism
    Noc_1347
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Noc_1347
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Noc_1347
Enzymes [BR:noc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Noc_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABA57842
UniProt: Q3JBF4
Position
complement(1495811..1496818)
Genome map
AA seq 335 aa AA seqDB search
MKVLAADIGGTKTLLQIADWGENTPQVLAEQRYLSGDYSSFDDLLRTFLTETSSTGNGLR
GACFAVAGVVTQGVATATNLPWRLDATHLEATFELPQVVLINDFTAIGYGIEGLTPDDFA
ILQSGKPEAAAPQAVIGAGTGLGQALLVWQEQTGHYQVLPTEGGHVDFAPQGKLQIALLT
YLSRQLDHVSYERVLSGGGLVTLYHFLKETSGMAESPALKKALSEGDQAAAISRSALEHG
DPLAGQALDLLVQIYGAQAGNLALACLPRGGLFVAGGIAPKILERLQAGGFMEAFLSKGR
LSELMQQIPVKVILESKVGLLGASRLAMRLAYEQL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattggctgcggatattggaggaaccaaaaccttacttcagatcgctgactgg
ggggaaaacactccgcaggttcttgcggaacagcgttatctcagcggtgattattcaagc
tttgatgatctcctgcgaacatttttgacagagacgagcagtacaggaaacggccttagg
ggtgcttgttttgctgtagcaggcgtcgtgacgcaaggcgtggcgacggccactaatctc
ccctggcggctggatgcaacacatttggaggcaacattcgagctgcctcaagtggtttta
atcaatgatttcacggccatcggctatggcattgaaggtctaacgccagacgatttcgca
atactccagtcaggcaagccggaagccgccgctccccaggcggttattggcgctgggacc
gggcttggacaggcattgctcgtatggcaggagcaaacgggtcactaccaggttttacct
actgaaggaggtcatgtagactttgcccctcagggaaaactccagattgcattgctgact
tatctttctcgtcagttagaccatgtttcctacgaacgggtattatcaggcggcggctta
gtcacgctctaccattttttgaaggaaaccagcggcatggctgaaagcccggccttgaaa
aaggcgttgagcgagggcgatcaggcagcggccatcagccgctctgctctggagcatgga
gacccgttagcaggacaagcgttggatctgctggtccagatctatggcgcgcaagcgggc
aatttagccctagcttgtttaccgcggggaggacttttcgttgctggcggcatcgcgccc
aagatcctcgaacgcctgcaggcgggcggatttatggaggctttcctaagtaaaggacga
ctctctgagcttatgcaacaaatccctgtcaaggtcatattggagtccaaggttggcctg
ctgggagcctcgcgattagcaatgagattagcttatgagcaattatag

DBGET integrated database retrieval system