KEGG   Nitrosococcus oceani: Noc_1395Help
Entry
Noc_1395          CDS       T00281                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
noc  Nitrosococcus oceani
Pathway
noc00010  Glycolysis / Gluconeogenesis
noc00260  Glycine, serine and threonine metabolism
noc00680  Methane metabolism
noc01100  Metabolic pathways
noc01110  Biosynthesis of secondary metabolites
noc01120  Microbial metabolism in diverse environments
noc01130  Biosynthesis of antibiotics
noc01200  Carbon metabolism
noc01230  Biosynthesis of amino acids
Module
noc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noc_1395
  Energy metabolism
   00680 Methane metabolism
    Noc_1395
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Noc_1395
Enzymes [BR:noc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Noc_1395
Membrane trafficking [BR:noc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Noc_1395
Exosome [BR:noc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Noc_1395
  Exosomal proteins of melanoma cells
   Noc_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABA57888
UniProt: Q3JBA8
Position
1546026..1546748
Genome map
AA seq 240 aa AA seqDB search
MILLRHGESVWNLENRFTGWTDVDLSANGVEEARLAGKILKNEGYQFDKAYTSVLKRAIR
TLWIVEEMMDLVWLPVEKRWELNERHYGNLQGLNKAEMAKQYGAELVHQWRRGYGIEPPP
LDNSDPRHPRFDRRYAGLAPEALPASESLKKTLKRVIPCWKQHILPDIAAGKELIIVAHG
NSLRALYKHLEGLSDQEVMELNIPTGIPLVFELDSAFRPTAHYYLADSEKSQVVIGDTAH
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgatattacttcgtcatggtgaaagcgtgtggaatttggagaatcggttcaccggttgg
acggatgtcgatctttccgcaaatggcgttgaagaagcccgtcttgcaggtaagattttg
aaaaatgaagggtatcaattcgataaggcctatacgtcggtacttaagcgggctattcgt
accctctggatcgtagaagaaatgatggatctggtatggctccctgtggagaaacggtgg
gagctaaatgagcgtcactatggcaacctgcaagggttgaacaaagcagaaatggctaag
caatatggtgcggagctagtgcatcagtggcgccggggttatggaatagagccaccgcca
ttggataattctgatccacggcacccacgcttcgataggcgttatgcaggtttggctcct
gaagcgttgccagcatcagaatcccttaaaaaaacccttaagcgggttattccatgttgg
aagcaacacatcttaccggatattgctgctggcaaggagttgattattgttgcccacggt
aattccttgcgggctttatataaacatcttgagggattatctgatcaggaggtgatggag
cttaatattcctacgggtattcccttggtgttcgagttagacagtgctttcaggccaacc
gcccattattatttagctgattctgaaaagagtcaggtggtgatcggcgataccgcccat
tag

DBGET integrated database retrieval system