KEGG   Nitrosococcus oceani: Noc_2100Help
Entry
Noc_2100          CDS       T00281                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
noc  Nitrosococcus oceani
Pathway
noc00780  Biotin metabolism
noc01100  Metabolic pathways
Module
noc_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:noc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Noc_2100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:noc01007]
    Noc_2100
Enzymes [BR:noc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Noc_2100
Amino acid related enzymes [BR:noc01007]
 Aminotransferase (transaminase)
  Class II
   Noc_2100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABA58560
UniProt: Q3J9D6
Position
complement(2413766..2414899)
Genome map
AA seq 377 aa AA seqDB search
MELRQRQTQSLYRYRRVLEGPQGAELQMDGRRILAFCSNDYLGLANHPATRAAFMQGVRE
YGVGSGAAHLVTGHSRAHHTLEEALAAFVGRPRVLLFSTGYSANLGVISALIGRQDAVFE
DRLNHASLLDGGLLAGARFKRYRHRDYQSLEAALTATKARRRLVVTDGVFSMDGALAPLP
DLAAVADRFDAWLMVDDAHGLGVLGEEGRGSVAHFGLGMAQAPILVGTLGKALGTFGAFV
AGEEALIETLIQQARTYIYTTAPPSAVAVATLASLRLVETESWRRDKLTRLIAQFRQGAA
QLGLQLVDSPTPIQPLLVGDAGAAVKLSERLLAQGILVTAIRPPTVPEGSARLRITLTAA
HSEAQVARLLESLVQVL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaggcagcgccagactcagtctctttaccgctatcggcgggtattggaaggt
ccccagggggcggagctccaaatggatggccgccgaattttagccttttgcagcaatgac
tatttaggtctggcgaatcaccccgcaacccgggctgcctttatgcaaggagtccgagag
tacggggttggcagtggggcggcccacctagtgacgggccatagccgtgcccatcatacg
ctagaggaggctctggcggcgtttgtgggacggccccgggtgttgctgttttctaccggt
tattcggccaatcttggggttatcagcgccctaatagggcgtcaagacgcagttttcgag
gatcgcctcaatcatgcctccttgctagatggggggctgcttgcgggtgcccgctttaaa
cgctatcggcaccgggattatcagtccctcgaagccgctttaactgccaccaaggcccgc
cgcagattggtggtgacggatggggtttttagcatggatggggcgctggctcccttgccg
gacctggctgcagttgccgaccgttttgatgcttggctgatggtggatgatgcccatggt
ctgggcgtcttgggcgaagaagggcgtggcagcgtggcccattttgggctgggaatggcc
caggcgcctattttggtgggtaccttgggtaaagccttgggcaccttcggggcctttgtg
gccggtgaggaggcccttattgaaaccttgattcagcaagcgcggacctacatctatact
acagccccgccctctgcggtggccgtagcgaccctggccagtttgcggctggttgaaacc
gaatcctggcgtcgggataaattaacccgcttgattgcccaatttcggcaaggcgccgct
cagttggggcttcagctcgtggattccccgacccctatccagccgttgctggtgggagat
gctggggctgcagttaaactgagcgagcgcttgcttgcgcaagggatactggtgactgcc
atccgcccgcccacggtgccagagggaagtgcccgcctacgaattactttaacggcggct
cattccgaagcccaggtagcacgcttgctggagtcgctagttcaagttttatga

DBGET integrated database retrieval system