KEGG   Nitrosococcus oceani: Noc_2280Help
Entry
Noc_2280          CDS       T00281                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
noc  Nitrosococcus oceani
Pathway
noc00040  Pentose and glucuronate interconversions
noc00052  Galactose metabolism
noc00500  Starch and sucrose metabolism
noc00520  Amino sugar and nucleotide sugar metabolism
noc01100  Metabolic pathways
noc01130  Biosynthesis of antibiotics
Module
noc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:noc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Noc_2280
   00052 Galactose metabolism
    Noc_2280
   00500 Starch and sucrose metabolism
    Noc_2280
   00520 Amino sugar and nucleotide sugar metabolism
    Noc_2280
Enzymes [BR:noc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Noc_2280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABA58738
UniProt: Q3J8V8
Position
complement(2630379..2631272)
Genome map
AA seq 297 aa AA seqDB search
MTKPITKAVFPVAGLGTRFLPATKANPKEMLPIVDKPLIQYAVEEAVEAGIKVMVFVTGR
NKRPIPDHFDMAYELEAELERRGKNKLLKLVQDIIPRDVTCVYIRQEETLGLGHAVLCAA
PVVGEEPFAVILADDLIDAGMEGCLSQMVKQFSKHHCSLVGVEEVASDSTDQYGIIQPGL
AEDREYKVEGIVEKPEPAEAPSSLAVVGRYILTPRIFSLLEATPHGVGGEIQLTDALATL
LSEEYMFAYRFEGKRYDCGSKLGYLQATVEYGLKHTELGDPFRDYLCGLVAQIEAPL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacccattactaaagctgtattccctgtggcgggattaggaacccgtttcctt
cccgcgaccaaagcaaacccaaaagagatgctgccaatcgtcgataagcctctcattcaa
tatgcggttgaagaagcggttgaggcagggatcaaggttatggtttttgttactgggcgg
aataagcgtccgattcctgatcatttcgatatggcttatgaacttgaagcagaactggaa
agacgcggtaaaaacaagctactcaagttggtacaggacattattcctagggatgtgacc
tgcgtttatatccgtcaggaggaaactttagggttagggcatgcggtgctttgtgccgcg
ccagttgtgggcgaagagccctttgcagtgatccttgctgatgatctgattgatgcgggg
atggagggatgtctctcccaaatggtgaagcaatttagtaagcatcattgcagcctagtg
ggcgtggaggaggtcgcttctgacagcaccgatcaatacggtattattcagcctggcttg
gcagaggaccgggagtacaaagtggaaggaattgtcgagaagcctgaaccggcagaggcc
ccctcatccttggcggtggtagggcgttatattttaaccccccgtattttcagtctatta
gaagctacccctcacggagttgggggagaaattcaattaactgatgcccttgctacttta
ttaagcgaggagtatatgtttgcttatcgctttgaaggcaagcgctatgattgtggcagt
aaattaggctaccttcaagccacagtggagtacggccttaagcataccgagttaggcgat
cctttcagagactatttatgcggcttggttgctcaaattgaggccccgctttga

DBGET integrated database retrieval system