KEGG   Nitrosococcus oceani: Noc_2848Help
Entry
Noc_2848          CDS       T00281                                 

Definition
(GenBank) ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
noc  Nitrosococcus oceani
Pathway
noc00051  Fructose and mannose metabolism
noc01100  Metabolic pathways
noc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:noc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Noc_2848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:noc04147]
    Noc_2848
Enzymes [BR:noc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     Noc_2848
Exosome [BR:noc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Noc_2848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: ABA59294
UniProt: Q3J7A2
Position
3225508..3226380
Genome map
AA seq 290 aa AA seqDB search
MAKVLGIGTATLDIINTVEYYPTEDEELRVLSQRRCVGGNCPNTLTVLQQLSHKCVFAGI
MADDPDGRFIAQQLKQTGVKVDDCRVVEGRTPTSYITLSRATGTRTIVHYRALPEFSFAD
FAKIDLSSFDWLHFEGRNITETLGMLTFVRKKFPYLPWSVEIEKPRANIENLFEGATILL
FSRHYAAYHGYAKAQTFLQELHSSLPHTEKVCAWGKEGAYALGNGGEIKHAPAFFPPQVV
DTLGAGDTFNAGFLNARLRNHSLSESLTLACQLAGRKCGQQGFNGLGDQR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggtactcggtatcggaactgccacccttgatatcattaacaccgttgaatat
tatcctacggaggatgaagaactcagggttttatcacagcgccgctgcgtggggggaaat
tgtcctaatacccttactgtcctccaacaactcagccacaaatgcgtttttgcagggatt
atggcggatgatccagacggacggttcattgcccaacaattgaaacaaacaggtgtcaaa
gtagatgattgccgggtggtggaaggaaggacacctacatcctatattaccttaagccgc
gctacaggcacccgcacaattgtccactatcgggccctccccgaatttagctttgccgat
ttcgcaaaaattgatctctcctcttttgattggctccactttgaaggccgcaatattacg
gaaacgcttggcatgctaaccttcgtccggaagaaatttccttaccttccctggtcagtg
gagattgaaaaacccagagccaacattgaaaatctttttgagggcgccactattttatta
ttctcccgccattatgcggcttaccatggctatgcaaaagctcaaacttttcttcaggag
ttgcactcatccctgccccacactgaaaaagtctgcgcttggggcaaggagggagcctac
gctcttggtaatggaggggagataaaacacgcaccagcttttttcccaccccaggtggtg
gataccctgggggcgggagatactttcaacgcggggtttcttaatgcccgtctgcgtaac
cactctctttctgaaagccttactttggcgtgccagctagctggccgtaagtgtgggcag
cagggattcaacggtctaggagaccagcgataa

DBGET integrated database retrieval system