KEGG   Nocardia otitidiscaviarum: FOH10_31805Help
Entry
FOH10_31805       CDS       T06114                                 

Gene name
lhgO
Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
nod  Nocardia otitidiscaviarum
Pathway
nod00310  Lysine degradation
nod01100  Metabolic pathways
nod01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nod00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    FOH10_31805 (lhgO)
Enzymes [BR:nod01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     FOH10_31805 (lhgO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 NAD_binding_8 NAD_binding_9 FAD_oxidored Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QDP82630
UniProt: A0A516NUN4
Position
complement(7069773..7070957)
Genome map
AA seq 394 aa AA seqDB search
MYDYCVIGGGIVGVATAHRLLSRHPGASLLLVEKAAALGTHQTGHNSGVIHSGIYYAPGS
LKARLCREGARRTKEFAAAHDIPFQVCGKLLVATDSAEHARMLALYERAVTNGVDVELLD
AAELRRREPRVTGVGALFVPDTGIIDYSRVTAALAAQVRAAGGTVILGAEITAIDETGDA
VTVSGPAGSWRARRLVVCAGLQADRLARLAGLRTQLRIVPFRGEYYQLPPARKDLVRTLI
YPIPDPELPFLGVHLSPTIDGDLTVGPNAVLGLAREGYRKGSVDLRDVREILGFRGFHRV
AAANVRTGVRELRNSLFKRGYLAECRRYCPELTLDDLLPREAGIRAQAVLRDGTLVHDFL
LEKTERSVHVLNAPSPAATSALPIAAHIVNELDG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgactactgcgtgatcggtggcggcatcgtcggcgtggccacggcccaccggctg
ctgtcccgccaccccggggcgagtctgctgctggtggagaaggccgccgcgctgggcacc
catcagaccgggcacaacagcggcgtcatccactccggcatctactacgcgccgggcagc
ctgaaggcgcggctgtgccgggagggggcgcggcgcaccaaggaattcgcggcggcacac
gacattccgttccaggtgtgcggaaaactgctggtggcgaccgattccgccgagcatgcc
cggatgctggcgctgtacgagcgggcggtcaccaatggcgtggacgtggaactgctcgac
gccgccgaactgcggcggcgcgagccccgggtgaccggggtgggcgcgctgttcgtcccc
gacaccgggatcatcgactactcccgggtgacggccgcgctggcggcgcaggtgcgggcc
gcgggcggcaccgtgatactcggcgcggagatcaccgccatcgacgaaaccggcgacgcg
gtcaccgtttccggcccggccggaagttggcgggcccggcggctggtggtgtgcgcgggt
ctgcaggcagatcggctggcacggctggcgggcctgcggacccagctgcgcatcgtgccg
ttccggggcgagtactaccagctgccgccggcccgcaaagatctggtgcgcaccctcatc
tatcccatcccggaccccgaattgcccttcctgggtgtgcatttgagccccaccatcgac
ggcgacctgaccgtcgggccgaacgcggtactgggcctggcccgcgagggctaccgcaag
ggcagcgtcgatctgcgtgatgtgcgggagatcctgggattccggggttttcaccgggtg
gcggcggccaatgtgcggaccggcgttcgggagctgcgcaattcgctgttcaagcgcggc
tacctggccgaatgtcggcgctactgcccggagctcacgctcgacgacctgctgccgcgc
gaggcgggcatccgggcgcaggcggtgctgcgcgacggcacgctcgtccacgactttctg
ctcgagaagacggagcggtcggttcacgtcctgaacgccccctcacccgccgcgacatcg
gcgctgcccatcgcggctcacatcgtcaatgaattggacggttga

DBGET integrated database retrieval system