KEGG   Nostoc sp. CENA543: CLI64_12085Help
Entry
CLI64_12085       CDS       T05285                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00220  Arginine biosynthesis
noe01100  Metabolic pathways
noe01110  Biosynthesis of secondary metabolites
noe01130  Biosynthesis of antibiotics
noe01230  Biosynthesis of amino acids
Module
noe_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CLI64_12085 (argF)
Enzymes [BR:noe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CLI64_12085 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AUT01081
UniProt: A0A2I8A6U1
Position
2949738..2950658
Genome map
AA seq 306 aa AA seqDB search
MAALIGRDLLSLADLNPTELQELLQLATQLKSQKLQLRCNKVLGLLFSKASTRTRVSFTV
AMYQLGGQVIDLNPNVTQVSRGEPVQDTARVLDRYLDILAIRTFAQQELETFADYAKIPV
INALTDLEHPCQILADLLTVQECFGTLAGLTLTYVGDGNNVANSLLLGCALAGMNVRIAT
PQGYEPDPNIVEQTRAIAGDKTEVLITHDPHLATKGASVLYTDVWASMGQEAEAGDRFPI
FQPYQISEELLSLADPEAIVLHCLPAHRGEEITEEVMEGSHSRIWDQAENRLHAQKALLA
SILGAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcagcattgattggaagagatttattaagtctggcagacttgaatcctacggaactt
caagaacttctgcaattggcgactcaattgaaatcgcaaaaattgcaattgcggtgtaat
aaagtcttgggtttgttgttttctaaggcttcaactcgcacaagggttagctttacggtg
gcgatgtatcaattgggtggacaagttattgatctcaaccctaatgtcactcaagttagt
cggggcgaacctgtacaagatacagcacgagtattagatcgctatttagatattctggca
attcgcacctttgctcaacaggagttggaaacttttgctgactatgccaaaattcctgta
attaatgcgctgacagatttagaacatccttgccaaatattagctgatttattaactgtg
caggaatgtttcgggactctggcagggttaactttaacctacgttggtgatggcaataat
gttgctaactctttgcttttgggttgtgctttggcgggaatgaatgtcagaatcgccact
ccccaaggttatgaaccagatcctaacattgtggagcaaacacgggcgatcgcaggagat
aaaactgaggtgttaattactcatgatccacacttagccacaaagggcgcatctgtactc
tacactgatgtttgggcaagtatgggacaagaagcagaagcaggcgatcgcttccctatt
ttccaaccatatcagatttctgaagagttattgagtctcgctgacccagaggcgattgtt
ttacactgtttacccgcccatcgtggggaagaaattactgaagaagtaatggaaggttcc
cattcacgcatttgggatcaggcggaaaatcgtctgcacgcacaaaaggctttgttagcc
agtatcttaggtgctgattga

DBGET integrated database retrieval system