KEGG   Nostoc sp. CENA543: CLI64_12395Help
Entry
CLI64_12395       CDS       T05285                                 

Definition
(GenBank) bile acid beta-glucosidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00511  Other glycan degradation
noe00600  Sphingolipid metabolism
noe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CLI64_12395
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CLI64_12395
Enzymes [BR:noe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CLI64_12395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-ProteinID: AUT01139
UniProt: A0A2I8A701
Position
3022604..3025036
Genome map
AA seq 810 aa AA seqDB search
MTNPTSPQIPACTWHRSIGLGWDKPYTVRYASNIDDGPWHGMPLGGFGAGCIGRSSRGDF
NLWHIDGGEHVFQNFPACQFSVFESDGTSSQAYALATTAPTDGTLQTWQWYPANQAGEQG
SRGAGEISHTGTYHALYPRSWFVYENVLQTQLTCEQFSPVWAHNYKETSYPVAVFVWQAH
NATNAPITLSIMLTWQNMTGWFTNALKSPEVKVRDDGSPVYEYQPRLGESRGNYNYLVES
PQALGCFLGREGTTEPLQEGEGSWCIATQKHPQVEVFYHSRWHPVGDGDEIWQSFSQDGS
LPDVIDITPAADNEQIGAAIAVRLTLQPGESLEIPFVLAWDFPVTEFAAGVNYHRRYTDF
FGTNGNNAWAIATTALTHYQTWQEQIQAWQQPILDREDLPNWFKMALFNELYDLTSGGTL
WSAATKHDPIGQFAVLECLDYRWYESLDVRLYGSFGLLLLFPELEKAVMRAFARAIPQGD
DTPRVIGYYYTIGAESPIAVRKAIGATPHDLGAPNEHVWEKTNYTSYQDCNLWKDLGCDF
VLQVYRDYLFTGANDVEFLQDCWDAVVQTLDYVKAFDLDGDGIPENSGAPDQTFDDWRLQ
GVSAYCGGLWMAALEAAIAISDILILNQPDAEKLLQQKSLYQTWLTQSLPIYQQKLWNGK
YYRLDSESGSDVVMADQLCGQFYAYLLDLPEIVPSDRAISALRTVYDACFLKFYNGQFGA
ANGVLPDGSPENPNATHPLEVWTGINFGLAAFLAQMGMKDEALRLTQAVVEQIYSNGLQF
RTPEAITPVGTFRASTYLRAMAIWGVYLVL
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatccaacctccccgcaaattcccgcttgcacttggcatcgttctattggttta
ggctgggacaaaccttatactgttcgctacgcaagtaatattgatgatgggccttggcat
gggatgcctttaggtggctttggtgctggttgcatcggacgttcttcgcggggagatttt
aatctatggcacattgacggcggtgaacacgtttttcaaaacttcccggcttgtcaattt
agtgtatttgaatctgacggcacatcttcccaagcttatgctttggcaacaacagcacca
acagatgggactctgcaaacatggcaatggtacccagctaatcaagcaggggagcagggg
agcaggggagcaggggagatatcccacacaggtacatatcacgcactgtatccccgtagc
tggtttgtgtatgaaaatgttttgcaaacacagctaacctgtgagcagttttcccctgtc
tgggcgcataattacaaagaaactagttatccggtggcggtgtttgtgtggcaagcacat
aatgccactaatgcacccatcactcttagtattatgctgacttggcagaatatgactggt
tggtttaccaatgccctcaaatctccagaggtgaaggtgcgagatgatggaagtccggtt
tatgagtatcagccgcgtttgggtgagagtcggggtaattataattatttagtggaaagt
ccccaagctttggggtgttttttaggaagggaggggacgacagaacctctacaggaaggt
gaagggagttggtgtattgccactcaaaaacatccgcaagtggaagtgttttatcatagc
cgttggcatcctgttggtgatggggatgaaatttggcaaagctttagtcaggatggttca
ttacctgatgtgatagatattaccccagccgcagacaatgaacaaatcggggcagcgatc
gcagttcgtttgactctgcaaccaggggaaagtctagaaattccctttgttctggcttgg
gatttccccgtcactgaatttgcggcgggggtgaattatcaccgcagatatacagacttt
tttggtactaatggtaacaatgcttgggcgatcgctactactgctttaactcattatcaa
acttggcaagagcaaattcaagcttggcagcaaccaattttagaccgggaagatttgccc
aattggtttaaaatggctctatttaatgaactatacgaccttaccagtggtggaactctc
tggagtgcagcgacaaaacacgatcccatcggtcaatttgctgtattagagtgtttagat
taccgatggtatgaaagtttagatgtgagattatacggttcttttgggttgttgttacta
ttcccagaactggaaaaggcggtaatgcgtgcatttgccagggcaattccccaaggtgat
gatacaccccgtgttattggctattactatactatcggtgcagaaagtcctattgctgtg
cgaaaagccattggtgccacaccccacgatttaggcgcgccgaatgaacacgtttgggag
aaaactaactacaccagttatcaagactgtaatttgtggaaggatttaggctgtgatttt
gtcttgcaggtttaccgtgattatctatttacgggtgccaatgatgtagagtttctccaa
gattgctgggatgcagttgttcagactctagattacgtcaaagcctttgatttagatggg
gatggcattcccgaaaactccggcgcaccggatcaaacctttgatgattggcgactgcaa
ggcgtgagtgcctattgtggcggtttatggatggcagccctagaagcagcgatcgccatt
agcgatattttaatcttaaatcagcccgacgcagaaaaattactccagcaaaaatctctt
taccagacttggctaacccaatccttacccatctatcaacagaaactctggaacggcaaa
tattatcgcctagatagcgaaagcggttccgatgtggtgatggcagatcaattgtgtgga
caattttacgcctacttactagatttaccagaaattgtgccgagcgatcgcgccatttcc
gccttaagaactgtgtatgatgcctgcttcctcaaattctacaacggtcaatttggtgca
gctaatggtgtacttcccgacggttcaccagaaaaccccaacgccacccaccccctagaa
gtatggacaggaattaactttggactagccgccttcttagcccagatgggaatgaaagat
gaagccttacgattaacccaagccgtagtggagcaaatttatagtaatggcttacaattt
cgcacaccagaagccattaccccagtcggaaccttccgcgccagtacctacttacgcgca
atggctatttggggggtttatttagtgttgtga

DBGET integrated database retrieval system