KEGG   Nostoc sp. CENA543: CLI64_22550Help
Entry
CLI64_22550       CDS       T05285                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00630  Glyoxylate and dicarboxylate metabolism
noe00710  Carbon fixation in photosynthetic organisms
noe01100  Metabolic pathways
noe01110  Biosynthesis of secondary metabolites
noe01120  Microbial metabolism in diverse environments
noe01200  Carbon metabolism
Module
noe_M00165  Reductive pentose phosphate cycle (Calvin cycle)
noe_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
noe_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CLI64_22550
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CLI64_22550
Enzymes [BR:noe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CLI64_22550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AUT02960
UniProt: A0A2I8AC57
Position
complement(5458638..5458967)
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLTDAQIEKQVQYILNQGYIPAIEFNETSEPTEFYWTMWKLPL
FNAQTTREVLGEVQACRSQYPGNYIRVVGFDNIKQCQVLSFIVHKPGRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccttaccaaaagaacgtcgttacgagaccctttcttacttaccccccctcacc
gacgctcaaattgaaaagcaagttcagtacatcctgaaccaaggttacatccccgcaatc
gaattcaacgagacttccgaacctacagaattctactggacaatgtggaagcttcccttg
ttcaacgcccaaaccactcgcgaagtattaggcgaagttcaagcttgccgttctcagtat
cctggtaactacatccgtgttgtaggttttgacaacatcaagcagtgccaagttctcagc
ttcatcgttcacaaacccggcagatactaa

DBGET integrated database retrieval system