KEGG   Nostoc sp. CENA543: CLI64_27625Help
Entry
CLI64_27625       CDS       T05285                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00051  Fructose and mannose metabolism
noe00520  Amino sugar and nucleotide sugar metabolism
noe01100  Metabolic pathways
noe01110  Biosynthesis of secondary metabolites
noe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CLI64_27625
   00520 Amino sugar and nucleotide sugar metabolism
    CLI64_27625
Enzymes [BR:noe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CLI64_27625
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     CLI64_27625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_I Hexapep PGM_PMM_II PGM_PMM_III NTP_transf_3 Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: AUT03858
UniProt: A0A2I8AEQ9
Position
complement(6620311..6622839)
Genome map
AA seq 842 aa AA seqDB search
MRAVLMAGGSGTRLRPLTCDLPKPMVPILNRPIAEHIINLLKRHQITEVIATLHYLPDVL
RDYFQDGSDFGVQMTYAVEEDQPLGTAGCVKNIAELLDETFLVISGDSITDFDLTAAIAF
HKQKQSKATLILTRVPNPIEFGVVITDAEGKIKRFLEKPSTSEIFSDTVNTGTYILEPEV
LEYLPDHTECDFSKDLFPLLLAKDEPMYGYIAQGYWCDVGHLDAYREAQYDALEEKVKLD
FAYKEETTGLWVGQNTYIDPSAHIETPAMIGSNCRIGARVQIEAGTIIGDNVTIGADANL
KRPIIWNGAIIGDEAQLSACVISRGTRVDRRAHVLEAAVVGSLSTIGEEAQISPSVRVWP
SKKIESGAILNINLIWGSTAQRNLFGQRGVQGLANIDITPEFAVKLGAAYGSTLKPKSKV
AVSRDQRNVSRMITRSLIAGLMSVGVDVQNLDSTAIPIARTVIPTMKIAGGIHVRVHPDR
PDYILIEFMDGKGINISKAQEKKIEGAFFKEDMRRALSHEIGDVAYPSQVIDLYCTAFEK
LLHVSTLRNSRAKVVIDYVYAVSGAVLPQMLDKFGADAVVLNASLNKNAVSTTDREALLT
QLGHVVEALKANFGVQVSANGEQLILVDESGFPIRGELLTALMVDMILTSNPRGTVVVPV
HSSSAVEQVARRHDGRVIRTKANATALMEACQKNSNVVLGGSGDTGFIFPQLHPGFDSMF
CIAKIIEMLTIQERSLATVRSELPRVIHKTHTIRCPWSAKGALMRYLVETHPAQNLELID
GVKIRQPFDDSWLLVLPDASEPLVHLYANSNERDWVDETVRDYRSRVQTFVERQQEYHPA
EV
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcagtgctgatggcaggcggttcagggacgcgacttcgcccgttaacttgcgat
ctaccaaaaccgatggtgccgattctcaatcgaccgatcgctgaacatattatcaattta
ctcaaaagacatcaaatcacagaagtgattgccacactgcattacttacctgatgttttg
cgagattattttcaggatggcagcgattttggcgtacaaatgacttacgccgtagaagaa
gaccaacctttggggacagcaggttgcgtaaaaaacattgccgaacttttggatgaaact
tttttagtaattagcggtgatagtatcacagattttgatttgacagctgcgatcgccttt
cataaacaaaaacaatcaaaagcaactttaatcttaaccagagttcctaaccccattgaa
tttggtgtagtaattactgatgctgaaggtaaaattaaacgctttttagaaaaaccctca
actagcgaaatcttttcagataccgttaacaccggtacttatattctcgaacccgaagtt
ttagaatatctcccagaccatacagaatgcgacttttctaaagatttattccccttgctg
ttagctaaagatgaaccaatgtatggttacatcgcccaaggctactggtgtgatgtcgga
cacctagatgcctatcgggaagcacaatacgatgctttagaagaaaaagtcaaactagat
ttcgcctataaagaagaaaccaccggcttgtgggtaggacaaaacacctacattgacccc
tcagcccatatcgaaaccccggcgatgataggaagtaactgccgcatcggtgcgagagtg
caaattgaagccggaacaatcattggggataatgtcaccataggtgcagatgctaatctc
aaacgtcccattatttggaatggcgcaatcattggtgacgaagcccaattgagtgcttgt
gtcatctcccgtggaacccgtgtagaccgtcgcgcccatgtcttagaagcggctgtggtt
ggttctttatccaccattggcgaagaagcccaaattagccccagcgtcagagtttggccg
agtaaaaaaattgaatccggcgcaatcttaaacattaacctgatttggggtagcaccgcc
caacgtaacttatttggacaacgtggcgtacaaggattagctaacatcgacatcacccca
gaatttgccgtgaaattgggtgctgcttacggttctaccttgaagccaaaatctaaagtg
gccgtctcccgtgaccaacgcaacgtttcccgcatgattactaggtcattaattgcgggg
ttaatgtcagtgggtgtagatgtgcaaaaccttgattctacagccattcccattgcgcgg
acagtcatccccacgatgaaaattgccgggggcattcatgtgcgagtacatcccgatcgc
ccagactacatcctgatagaattcatggatgggaaggggattaatatctccaaagcccaa
gaaaagaaaatcgaaggggctttctttaaagaagatatgcgccgcgccctcagccatgaa
atcggtgatgtcgcttaccccagtcaagttatagacctctactgcacagcctttgagaaa
ctactacacgtttccactctccgcaacagtcgggctaaggtggtaattgattacgtgtat
gcggtgtctggggctgttttaccgcaaatgttagacaaatttggggctgatgcggtagtt
cttaacgccagcttgaataaaaatgctgtatctacaactgatagagaggctttattaact
caattaggtcatgtggtggaagccttaaaagctaactttggtgtgcaggtatcagccaac
ggcgaacaactcatcttagttgatgagtccggtttccccattcgcggcgaactgttaacc
gcactgatggttgatatgattctcacctctaaccccagaggtacggtagttgtaccggtg
cattcatccagtgcagtggaacaagtcgcccgtcgtcatgatggccgggtaattcgcacc
aaagccaatgcgacagccttaatggaagcttgccagaaaaattctaatgtggtgttgggt
ggtagcggtgacactggttttatcttcccgcaactgcatccaggctttgattccatgttc
tgcattgccaagattatcgaaatgctgacaattcaagagcgatcgctagccacggtaaga
tcagaattaccccgcgtcatccacaaaacccacaccatacgctgtccttggtcggctaaa
ggtgcattgatgcgctacttagtggaaactcaccccgcccaaaaccttgaactcatcgat
ggcgtgaaaattcggcagccctttgatgatagttggctattagttttaccagatgccagt
gaacctttagtacatctgtatgctaacagtaacgaacgtgattgggtagatgagacagtg
agagattatcgttcacgggtgcaaaccttcgtagaaagacagcaggaatatcacccggcg
gaagtttga

DBGET integrated database retrieval system