KEGG   Nostoc sp. CENA543: CLI64_28845Help
Entry
CLI64_28845       CDS       T05285                                 

Definition
(GenBank) ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit N
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
noe  Nostoc sp. CENA543
Pathway
noe00860  Porphyrin and chlorophyll metabolism
noe01100  Metabolic pathways
noe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:noe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLI64_28845
Enzymes [BR:noe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     CLI64_28845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro GLE1
Motif
Other DBs
NCBI-ProteinID: AUT04065
UniProt: A0A2I8AFC9
Position
complement(6904785..6906188)
Genome map
AA seq 467 aa AA seqDB search
MTIAQESTALNFECETGNYHTFCPISCVAWLYQKIEDSFFLVIGTKTCGYFLQNAMGVMI
FAEPRYAMAELEEGDISAQLNDYEELKRLCEQIKRDRNPSVIVWIGTCTTEIIKMDLEGL
APKLEGEIGIPIVVARANGLDYAFTQGEDTVLAAMANRCPSQVPVAESEKHERNAIQKLL
NFGKKKEEVVQEESEYVDHPPLVLFGSLPDPVVTQLTLELKKQGIQVSGWLPAKRFTELP
VIEEGYYVAGVNPFLSRTATTLMRRRKCKLIGAPFPIGPDGTRAWIEKICSVFGITPQGL
EEREAQIWAGLEDYVKLIRGKSVFFMGDNLLEVSLARFLVRCGMTVHEVGIPYMDKRYQA
AELAMLEKACQEMGVPLPKIVEKPDNYNQVQRIYDLQPDLVITGMAHANPLEARGINTKW
SVEFTFAQIHGFTNARDILELVTRPLRRNHNLKDLGWDKLVKEEAKI
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgcgcaagaatcgacagctttaaattttgagtgtgaaactggaaattaccac
accttttgtccaattagctgtgtggcctggttatatcaaaaaatcgaagatagtttcttt
ttagtgattggtactaagacttgtgggtatttcctacaaaacgcgatgggggtgatgatt
tttgccgaaccccgttatgcaatggcagagttagaagaaggggatatttcagcacaactc
aatgattatgaagagttaaagcgattgtgtgaacagattaaacgcgatcgcaatcctagt
gtcattgtgtggattggcacttgcaccaccgaaatcatcaaaatggacttggaaggttta
gcacccaagttagaaggtgaaattggtattcctatcgtcgtggcgcgtgctaacggctta
gattacgcctttacccaaggggaagacaccgtgttagctgcaatggctaaccgttgtcct
agtcaagttccggtagcggaaagcgaaaaacatgagcgtaacgctattcaaaagctgctc
aatttcggtaagaaaaaagaagaagtagttcaagaagaatcagagtatgtagatcatccc
cccttggttcttttcggttctctacctgatcccgtggtgactcagttaaccctagaactc
aaaaaacaaggaattcaagtttccggctggctacccgcaaaacgctttaccgaactccca
gtgatagaagaagggtattatgtcgctggtgtcaaccccttcctcagtcgcaccgctacc
accttaatgcgccgacgcaaatgtaaactcatcggcgcacccttccccatcggccccgat
ggaactcgcgcttggattgaaaaaatctgctcggtatttgggattacaccccaaggttta
gaagaacgggaagcgcaaatttgggcggggttggaagattacgtcaaattaattcggggt
aaatctgtatttttcatgggtgacaacttgctagaagtttccttagcacggttcctagta
cgctgcgggatgactgtacatgaagttggtatcccctatatggataaacgctatcaagcg
gctgagttagccatgttagagaaagcctgtcaagaaatgggtgtacccctgccaaaaatt
gtcgagaaaccagataattacaaccaagtacagcgaatttatgatttgcagccagattta
gtcattactgggatggcgcacgctaaccccttagaagcacgagggatcaatacaaaatgg
tctgtggagtttacttttgctcaaattcacggttttaccaatgcgcgtgacattttagag
ttagtaactcgtccactgcgtcgtaatcataatttgaaagatttaggttgggataagttg
gtgaaagaagaagcgaagatttga

DBGET integrated database retrieval system