KEGG   Novosphingobium sp. Gsoil 351: GKE62_05260
Entry
GKE62_05260       CDS       T06443                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
nog  Novosphingobium sp. Gsoil 351
Pathway
nog00626  Naphthalene degradation
nog01100  Metabolic pathways
nog01120  Microbial metabolism in diverse environments
nog01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nog00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    GKE62_05260
Enzymes [BR:nog01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     GKE62_05260
SSDB
Motif
Pfam: DHDPS CutC
Other DBs
NCBI-ProteinID: QGN54037
UniProt: A0A6I5WV49
Position
1105091..1106077
AA seq 328 aa
MARTLLSPGDVKGGWAIIPTPAKDDASDWRATKTVDIDETARVVNGLIDAGIDGILSMGT
LGEAATMTHDEKLDFMKALVDAAAGRVPIFVGTTCINTRDTVALTRQALNIGADGTMLGL
PMWCAPSRDVAVQFYKDVAEAVPEMNIAIYANPEAFKFDFPQPFWAQVAEIPQVVTAKYI
GVGNLLGDLAAIRGRIKLLPIDFDYYAAARMDDSIDAFWSSGAVCHPLVTTTLRDVVAAA
RTSGDWGAARAFQARLGPTAATLFPNGSFKEFSTFNIPLEKARMNAGGWMKAGPVRPPYH
LCPEPYLEGARKSGQMWADLGRALEAQD
NT seq 987 nt   +upstreamnt  +downstreamnt
atggcgcgcacactcttgagccccggtgacgtcaagggtggttgggccattattccgacc
ccggcgaaggacgacgcttcggattggcgcgcgaccaaaaccgtcgatatcgacgaaacc
gcgcgggtggtgaatggcctgatcgacgcgggaatcgacggtatcctcagcatgggcacg
ctgggtgaagcggcgacgatgacccatgacgagaaattagatttcatgaaggcgttggta
gatgccgccgccggacgggtaccgatctttgtcggcacaacctgtataaacacccgcgac
acggtggcgctgacccggcaggcactcaatatcggcgcggacggcacgatgctcggtttg
ccgatgtggtgcgcgcccagcagggatgtcgcggtccagttctacaaggacgtggccgag
gcggtgcccgagatgaacatcgcgatctatgccaatcccgaggctttcaagtttgacttt
ccgcaaccgttctgggcccaggttgccgaaattccccaggtcgtcaccgccaaatacatc
ggcgtcggcaatctgctgggcgaccttgcggcgatccgcggccggatcaaactgctgccg
atcgatttcgattactacgctgccgcgcgcatggacgattcgatcgacgctttctggtcg
agcggggcggtctgccatcctctcgtgaccaccacgctgcgggatgtggtcgccgcagcg
cggaccagcggcgactggggggcggcgcgagcctttcaggcgcggctgggtccgaccgcg
gcaacccttttcccgaacggcagtttcaaggaattctcgaccttcaacatcccgctcgaa
aaagcgcggatgaacgccggtggctggatgaaggccggaccggtgcgtccaccctatcat
ctttgccccgagccctatctcgaaggcgcacgcaagtcgggccaaatgtgggccgacctg
ggccgggcactcgaagcacaagactga

DBGET integrated database retrieval system