KEGG   Nonlabens sp. MJ115: EJ995_04965Help
Entry
EJ995_04965       CDS       T05856                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
noj  Nonlabens sp. MJ115
Pathway
noj00900  Terpenoid backbone biosynthesis
noj01110  Biosynthesis of secondary metabolites
noj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:noj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EJ995_04965
Enzymes [BR:noj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     EJ995_04965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AZQ43616
UniProt: A0A3S9MWK6
Position
1100996..1102306
Genome map
AA seq 436 aa AA seqDB search
MRQPVQGFSRLSKTEKIDWLIAHNLNNDPTAREILLQYWNSDEKLQELHDGFSENTISNY
YLPLGLAPNFLINDKLVTIPMVIEESSVVAAASKAAKFWLDRGGFKTTIKGTTKSGQVHI
TYAGLRSEMDAFYAFAKADLLQSTEQINASMKARGGGLLDLQLVDKTKDLQGYYQLHATF
DTRDAMGANFINTMLEQLATTFREKAAQFQGFSIAPPEVVMSILSNYVPDCTVHVETRCS
IDKLGIINGISGADFARKFVQAVDIAIAEPYRAVTHNKGIMNGIDAVVLATGNDFRAVEA
GVHAYAARDGQYRSLTRARVEDNELIFEAEFPLALGTVGGLTSLHPLAKLSLQIMGNPDA
RELMSFTAVCGLAQNFAALHSLVTTGIQAGHMKMHLANMLEQVGATDAEKVKLREAFSKT
TPSYSSLKEEIQKLRS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacctgttcaaggattttccagactttccaaaaccgaaaaaattgactggctc
atcgcccataatctcaacaacgatcctacagctcgcgagatactcttgcaatactggaac
agcgacgagaaattacaggaattgcacgatggctttagtgagaataccatctcaaattat
tatttgccgctaggtctggctcccaattttttgatcaatgacaagctcgtcaccattcct
atggtgattgaagagagtagtgtggtggctgctgccagtaaggcggcaaaattctggctg
gatcgcggtggattcaagacgacgattaagggcacgacaaaatctgggcaggtacatatt
acctatgctggattgcgcagtgagatggatgctttttatgctttcgcgaaagctgactta
ttacaatctactgagcaaatcaatgctagtatgaaagctcgaggtggtggcctgctagac
ttgcagctggtggataaaaccaaagatctacaaggatactatcaattgcacgcgacattt
gacacgcgcgatgcgatgggagccaattttatcaataccatgcttgagcaactagcgacg
acatttagagaaaaagctgctcaatttcagggcttttctattgctccaccagaggttgtt
atgagcatcttgagcaattatgtgccagattgtactgttcatgtggagactagatgcagt
atcgataaattgggtatcatcaacggcattagcggtgcagactttgcccgcaagtttgtg
caagccgttgatatcgccattgccgagccttaccgagcggtaacacacaataaaggaatt
atgaacggcattgatgccgtggtgcttgccacgggaaatgactttagagctgtagaagct
ggtgttcatgcctatgccgcgcgcgatgggcagtatcgcagtttgacgcgcgctagagta
gaggacaacgaactgatttttgaagcagaattcccattggctttaggaacggttggtgga
ttgacttcgctgcatccactggcaaaattatccttacaaattatgggcaatcccgatgct
cgtgaactcatgtcttttactgccgtttgtggattggctcaaaattttgctgcattacat
tcattagtaaccacaggaatccaggcaggacacatgaaaatgcatctagcaaacatgctg
gaacaagtaggcgcaaccgatgctgaaaaagtcaagttaagagaagctttttcaaagacc
acacctagctattcttccttaaaagaagaaatacagaaactaagatcctga

DBGET integrated database retrieval system